KEGG   Rahnella sp. Y9602: Rahaq_4579
Entry
Rahaq_4579        CDS       T01422                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
rah  Rahnella sp. Y9602
Brite
KEGG Orthology (KO) [BR:rah00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rah02044]
    Rahaq_4579
Secretion system [BR:rah02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq_4579
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ADW76160
UniProt: A0A0H3FH80
Position
pRAHAQ01:146789..148558
AA seq 589 aa
MDDLTLRYYEAEMRYLREAGREFAHAHPDRAAMLNLDKSGARDPYVERLFEGFAFLMGRL
REKLDDDLPELTEGLVSLLWPHYMRTIPSLAIVELKPDYRQLKQVEIVPRGFSVLSQPVG
QKHTCCQYQVTRDMPLMPINISQAKLHTETDGRSTVRLRFDCGPLADWRKIDLSRVAIYL
DADSPVSSALHLALTRKVQTMYVRQPELGQDRRAIDGWFKPMGFEENERLWPKGSSAFSG
YQLLLEYFTFRPKFMFVELNGLQNVHLVPGTTWFELDIVLSELWPYDLPFDTDTFRLHCV
PVINLFSLEADPLQIDPLANEYLLRPLRMQDGHVEIYSVDQVHGSVKNGKHDYVPFTSFR
HRGGMMRHDAPERYFHTRVKRGPSGLHDTWLILGGKSFEAEQLAEQREALSLRITGTNGQ
LPRKALESTLLNRVVKAGKVPVQVRNLTTPTMPVYPPANDRFHWRVMSHLGSSFLSMMDN
PEVLRGTLALYDWTDDEMNCRRLEAIVAVEHHLIQRFEKGFMLRGVDIEITLNTDNFAGE
GDVNLFGEMLHRFFALYADIHLFNQLTLVLQPTGKRLRWNENHSQHVPG
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggatgatttgaccctgcgctattacgaagctgagatgcgttacctgcgcgaggccggg
cgcgaatttgcccatgcccatcccgaccgggccgcgatgctcaacctggataagtccggg
gcgcgcgatccgtacgttgaacgtttatttgaaggtttcgcatttctgatggggcgtctg
cgggagaaactggacgatgacctgccggaactcacagagggactggtcagcctcttgtgg
ccacactatatgcggacaatcccttcactggccattgttgaattgaaacctgattaccgg
caactcaagcaggtggagatcgtgccccggggcttctctgtcctgtcacagcctgtcggg
caaaaacacacctgctgccagtatcaggtgacgcgggatatgccgcttatgccgatcaat
atttcacaggcgaagttgcatactgaaacagacgggcgttcaaccgtacgcctgcgtttt
gactgcggtccgctggcggactggcgaaagatagatttaagccgcgtggcaatctatctc
gatgccgacagtccggtcagcagtgctttgcatctggccctgacccgcaaagtgcagacc
atgtatgtccgccagccggagttgggtcaggatcgccgtgcgatagacggctggttcaag
cccatgggatttgaagaaaatgaacgcctgtggcctaaagggagctcggcgttcagtggc
tatcagttgttactggaatactttaccttccgcccaaaatttatgttcgttgagctgaat
ggactgcaaaatgtccatctggtaccggggacgacatggttcgaactcgatattgttttg
agtgagttgtggccttatgacctgccgtttgataccgataccttccggttacactgcgtt
ccggtcattaacctgttttcactggaagccgacccgctgcaaattgatccactggcgaat
gaatatcttttgcggccactgcgaatgcaggatggtcacgtagaaatctacagtgttgat
caggtacacggttccgttaaaaacggcaaacacgactacgtgcccttcaccagtttccgt
caccgcgggggcatgatgcgtcatgatgctcccgaacgctatttccacacacgtgttaag
cgcgggccttctggcttgcatgacacatggttaattctcggcggtaaatcctttgaagca
gaacagcttgctgaacagcgtgaagcactttcactgcgtattaccgggaccaacggccag
cttccacgtaaggcgctggaaagtaccctgctcaaccgggttgtgaaagccggcaaagtc
ccggtacaagttcgcaacctcaccacgcctaccatgccggtatatccgcctgccaatgat
cgcttccactggcgggtgatgagtcacctgggttcaagcttcctcagcatgatggataac
ccagaggtgctgcgaggcacgctggcgctgtatgactggaccgatgatgaaatgaactgc
cgcaggctcgaggcgattgttgccgtcgaacaccacctgatccagcgatttgaaaaaggg
ttcatgctgcgcggtgtcgatatagaaatcaccctgaatacagacaacttcgcgggtgaa
ggggacgtcaatctctttggtgaaatgctgcaccgcttctttgccttgtacgccgatatt
caccttttcaatcagctgacgctggtgttgcaaccgacaggaaaacgcctgagatggaac
gagaatcacagccaacacgtaccgggctga

DBGET integrated database retrieval system