KEGG   Rahnella sp. Y9602: Rahaq_4582
Entry
Rahaq_4582        CDS       T01422                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
rah  Rahnella sp. Y9602
Pathway
rah03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rah00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rahaq_4582
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rah02044]
    Rahaq_4582
Secretion system [BR:rah02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq_4582
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V DUF3540 Fil_haemagg_2 DUF3187
Other DBs
NCBI-ProteinID: ADW76163
UniProt: A0A0H3FMB4
Position
pRAHAQ01:150223..152745
AA seq 840 aa
MVDILKNLLPDATGLSRYSLDIWNSPYSLDVLNFRGEEQLSETFSYTVDVTCPEPDIGAA
QMLRQFASFTMGTPFQPERAVYGVIRDFQRLSTSADETLYRLELVPRLRLLENSTNSFIF
QNQSVPEVAEFILRKHGLEGQDFEFRLSHTYPDRELITQWGETDLQFIKRILAEVGIWFR
FEADTRLTCEKVLFGDGPEQYQFGVTLPYCEPSGMRDGHAESVWGLKIHWNAVTGKIFKR
DYNYREATTPLDVSAQVRSAAPVTGESYLYARPYREAGEDVDAAAETGAFYARIRHERKL
NHQCRIFARTTGSGLAPGQVLEPQAYPFSDLPDGILITRIVAKGSRTEHFRLNIWGMAYR
ETIGFRPEPPARPVLSGTIPARVESPTRGDTYAWLDNQGRYRVRIDGDRASADAGYAYLW
VRLAKPYGGDGYGWHMPLTDGTEVAIAFDGGDPDRPYIAAALHDSEHPDHVTERNHTRNV
LRTPSNNKLRMEDRRGEEHIKLATEYGKTQLNSGHIVDAQNAPRGEGFELRTDEHGVLRG
GKGVFLSADAQPQGQVLDNSAAMAEIEYLQGQVKALSLAAAEASALEADIAAQIAMFSER
LKPINQVVLASAPQGIALTSGEHLQLAAAKNMILNAGNNADIGVIKNLTVNTGEEMGIFA
LKGEMSLKAGEGRVDVQAQNNRLALAAGKKVSLTAVDGDILFSAKKRITLIGGGSYLILQ
DGKIEYGTAGEYFRKTPHTVLTVANPVRLKMPYLPGGGKFDLALDFRDEDSNAIANADYR
IIFESGSVLAGKLDEQGYALHKNVPFESASVEYVLPEPLPDPDWERYTSLDAATDSLLTK
NT seq 2523 nt   +upstreamnt  +downstreamnt
gtggttgatatcctgaaaaatcttctccctgatgcgacaggtctgtcccgctactcactt
gatatctggaacagcccttacagtctggacgtgctgaactttcgcggcgaggaacagctc
agcgagactttttcctacaccgttgacgtcacctgccccgaaccggatatcggtgccgcg
cagatgctgcgccagttcgccagcttcacgatgggcacgcctttccagcctgaacgcgcc
gtgtacggcgttatccgtgactttcagcgcctgtccacctccgccgacgaaaccctgtac
cgccttgagctggtgccgcgcctgcggctgctggaaaacagcaccaacagctttattttt
cagaaccagtcggtgcccgaggtggcagagtttatcctgcgcaaacacgggctcgagggg
caggattttgagtttcgcctcagccacacctaccccgaccgcgaactcatcacccagtgg
ggcgagaccgacctgcagtttattaaacgcattctggccgaggtcggtatctggttccgc
tttgaggcggacacccgcctgacgtgtgaaaaggtgctgttcggcgacgggccggagcag
taccagtttggcgtgaccctgccgtactgcgagccgtcggggatgcgcgacggccacgcc
gaaagcgtctgggggctgaaaatccactggaacgccgtcaccggcaaaatcttcaaacgc
gattacaactaccgcgaggcgaccacgccgctggacgtcagcgcgcaggtgcgcagcgcc
gcgccggtgaccggcgaaagctacctgtacgctcgcccttaccgcgaggccggtgaggac
gtggacgccgccgccgaaaccggcgcgttctacgcccgcatccgccatgaacgtaaactc
aatcatcagtgccggatattcgcccgcaccaccggcagcgggctggcgccgggtcaggtg
ctggagccgcaggcctatccgttcagcgacctgccggacggcatcctcattacccgcatc
gtcgccaaaggctcacgcaccgaacattttcgcctcaatatctgggggatggcctaccgc
gaaacgattggcttccgccccgaaccaccggcgcggccggtgctcagcggcacgataccg
gcgcgggtggaaagcccgacccgaggcgacacctacgcgtggctggataatcaggggcgc
taccgcgtgcgcattgacggcgaccgtgcgtcggcggatgccggttacgcgtacctgtgg
gtgcgcctcgccaaaccctacggcggcgacggctacggctggcatatgccgctgaccgac
ggcacagaagtggccatcgcctttgacggcggcgaccccgaccggccgtatatcgccgcc
gcgctgcacgactccgaacatcccgaccatgtgaccgaacggaaccacacccgcaacgtt
ctgcgcaccccgtcaaataacaagctgcggatggaggaccggcgcggtgaggagcacatc
aaactcgccaccgaatacggcaaaacccagctgaatagcgggcatatcgtcgatgcgcaa
aacgcaccgcgcggcgaaggttttgagctgcgcaccgatgaacacggcgtcctgcgcggc
ggtaagggcgtctttctcagcgcggacgcacagccgcagggtcaggtgctggataacagc
gcggcgatggctgaaatcgaatacctgcagggtcaggtgaaagccctcagcctggccgcc
gccgaagccagcgcgctggaggccgatatcgcggcgcaaatcgccatgttcagcgaacgg
ctgaagccgataaatcaggtggtgctggccagcgcgccacaagggattgcgctgaccagc
ggcgagcatctgcaactggccgccgccaaaaacatgatactgaacgccggtaacaatgcg
gatatcggggtgattaagaacctgaccgtcaacactggtgaggaaatgggcatctttgcg
ctgaagggcgaaatgagcctgaaggccggcgaaggcagggtcgacgttcaggcgcagaac
aaccggctggcgcttgcggcgggcaaaaaagtgagcctcacggcggtggacggcgacatc
ctgttcagcgcgaaaaagcgcatcacgctgataggcggcggcagttatctcatcctgcag
gacggcaaaattgagtacggcacggccggtgaatatttcaggaaaacgccgcatacggtg
ctgacggtggcgaaccctgtgcgactgaaaatgccctatcttccggggggcgggaagttc
gacctggcgctggatttcagggatgaagactcaaatgccatagccaacgcggattaccgc
atcatattcgaaagcggttcggtactggctggcaagcttgatgaacagggatatgcattg
cataaaaatgtgccgtttgaatcagccagtgtggaatacgttttgcccgaacccttaccg
gatccggactgggaacgctacacctcacttgatgcggcaacggacagccttttaacgaaa
taa

DBGET integrated database retrieval system