KEGG   Rahnella sp. Y9602: Rahaq_4798
Entry
Rahaq_4798        CDS       T01422                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
rah  Rahnella sp. Y9602
Brite
KEGG Orthology (KO) [BR:rah00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rah02044]
    Rahaq_4798
Secretion system [BR:rah02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq_4798
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ADW76377
UniProt: A0A0H3FGD8
Position
pRAHAQ01:complement(367893..368978)
AA seq 361 aa
MAGTPPDAGVVLMMPDDFDDDVKKKENVLKEFWRDKDGNDRAHAFNFYRFCQLLEKQLSD
NKPLGSTFSPKNDAVRFRPHPGMGFPVSELKAVETSEERPDAPPTVRTTFMGLYGVDSPL
PTGYIDDITQRREGHEALEAFLDIFNHRMMTQFYRIWRKYNYPATFEEGGTDKTSRSLMA
LTGITDSGDVPASRLLALLQPLVRTTRTAEGITSVIRSQAPNTQVTVKPHKVTRIPAGKR
ARFSFSAQQRLGDHLVLGSETSDANYCIGVEMFTEDPTEANGWLPGGQLREDVFTLLRVY
LGCDYDASLTLTIPMKLAPLPRLGDRTLFAGYNVVLGLREDNLDKMPEQVTMKLGRIRDK
R
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggccggaacgccgcctgacgcgggtgttgttctgatgatgccagatgattttgatgac
gatgtaaaaaagaaagagaacgtcctgaaggaattctggcgggacaaggacggtaacgac
cgggcgcacgcctttaacttctaccgtttctgccagctgctggaaaaacagctctcggat
aataaacctctcggcagcaccttctcgccgaaaaatgacgcggtgcgttttcgtccgcat
ccggggatgggttttccggtcagcgagcttaaagccgtcgaaacgagcgaagaacgcccg
gacgcgccgccgacggtgcgcaccacctttatggggctgtacggcgtggattcgccgctg
ccgaccggctacatcgatgacatcacccagcggcgcgaaggtcacgaggcgctggaagcc
tttttagacatcttcaaccaccggatgatgacgcagttttaccgcatctggcgaaagtac
aattatcccgccacctttgaggaaggcgggaccgacaaaacgtcgcgcagcctgatggcc
ctgaccggcatcaccgacagcggcgacgtgcccgcctcgcgattgctggcgttattgcag
ccgctggtcagaactacccgcacggcggaaggtatcaccagcgtgatccgctcgcaggca
cccaacacgcaggtcaccgtaaaaccgcataaggtcacgcggatacccgccggcaaacgt
gctagattctctttctcagctcagcaacgcctgggcgaccatctggttctcggcagtgaa
acctcggatgccaactactgcattggcgtggagatgtttaccgaagacccaactgaggcc
aacggctggctgcccggcggtcagttgcgggaagacgtctttaccctgctgcgcgtctat
ctggggtgtgactacgacgccagcctgacgctgaccattccgatgaagctcgcaccgctg
ccgcgtctgggcgatcgcactctgttcgcgggttacaacgtggtgctgggattgcgggaa
gataatctggataaaatgccggaacaggtgacgatgaaactgggcagaatcagggataag
aggtaa

DBGET integrated database retrieval system