KEGG   Rahnella sp. Y9602: Rahaq_4800
Entry
Rahaq_4800        CDS       T01422                                 

Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family
  KO
K11906  type VI secretion system protein VasD
Organism
rah  Rahnella sp. Y9602
Pathway
rah03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rah00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rahaq_4800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rah02044]
    Rahaq_4800
Secretion system [BR:rah02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq_4800
SSDB
Motif
Pfam: T6SS-SciN DUF1236
Other DBs
NCBI-ProteinID: ADW76379
UniProt: A0A0H3FGZ6
Position
pRAHAQ01:complement(370717..371250)
AA seq 177 aa
MTPDNFQRVRRGTVLLLLPLLISSCGLTQRVGSGASAVAEAVLYRKIDTLHLKLTSRAAL
NSNEGGEALPTVVRVYQLKDRKTFDTASYAALLRQDNTVLAADLLDRQVVQVMPDAEATV
AVPLHADAKFVAVVALFMAPDATNNTWRLVLERNDLDDSKDRIVELNDNRLQLRKNQ
NT seq 534 nt   +upstreamnt  +downstreamnt
atgacgcccgataatttccagcgagtaagacgcggcaccgtgctgttattactgccctta
ctgataagcagctgcggcctgacgcagcgcgtgggaagcggcgcctctgcggtcgcagag
gccgtgctctaccgtaaaatagacaccctgcatctgaagctgacctcccgcgccgcgctc
aacagcaacgaaggcggcgaggcgctgccgacggtggttcgcgtttatcagctcaaagac
cgtaaaacctttgatacggccagctacgccgccctgctcaggcaggacaacaccgtgctg
gccgctgacctgctcgaccggcaggttgtccaggtgatgccggacgcagaggcgacggtg
gccgtgccgctgcatgccgacgcaaagtttgtcgccgtggtggccctctttatggcaccg
gatgccacaaacaacacctggcggctggttctcgaacgtaatgacctcgatgacagtaaa
gaccggatcgttgagctcaatgacaaccggctgcagctcaggaaaaatcagtaa

DBGET integrated database retrieval system