KEGG   Rahnella sp. Y9602: Rahaq_4801
Entry
Rahaq_4801        CDS       T01422                                 

Definition
(GenBank) ImcF domain protein
  KO
K11891  type VI secretion system protein ImpL
Organism
rah  Rahnella sp. Y9602
Pathway
rah03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rah00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rahaq_4801
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rah02044]
    Rahaq_4801
Secretion system [BR:rah02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq_4801
SSDB
Motif
Pfam: IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: ADW76380
UniProt: A0A0H3FHY7
Position
pRAHAQ01:complement(371237..374605)
AA seq 1122 aa
MTKSLHLMLVVMLALALSLLWLNADGETLTHGVAWWATGVILLSYFLLARYAFALELLDF
NRPPEAQDDARITAFDTLRFTLRHRYGWHWKHKQPWLLVTGEAAVVEKVAPGLTQARWQE
SQNAVLIWCGEADALDLAAVTQLRDMRGRRAFNAVLWVTDVTAAPEYLWTTQPVPNQTLP
AGNSDTVYRQFIALGHTLSWRPPVFGVCLSEPQWEQDDRPVQSIGCHWPAGTPVSLDDQL
SQLAATLIPQGVAQLSENKHWAWLLQLSGDLKHHTGALLRQRFQPWLGEHQRVLAGGIFF
MPAAPEPASVQQRSHACYLSPAWNGVIAQSRTQQGRRDHLSTGDKLAIGTLTLAGLWVLG
MGISACANRTLIADSQALLQAARTPAPMSDTLTRSVALQDNIDRLLWWQQNGSPWLHRFG
LDQRDAVIEALWPAYTRQSQALLLTPMVNALKDRLQAFVSLPPGSAERRLAGKLAYQQLK
AYLMLLHPEHADPAFMQPVLSPLWTVPDGVAPGEWLARSDKLLGFYLQQLPRHLQWKLPA
DDQLVANVRTILRSQKGISNSENALYQQVLLSVSPHYADVTLDSLLGETAGGQLFSTDDN
LPGMFTREAWEGEVSDAIDKAAAARHVTSDWVLDDKGEQQLLTKDQLQYRLTERYFADYT
SAWLNFLNSIRWNTSDSLSTSLDQLTQLADARQSPLLALSRTLRYQGAAGQHREAMGDSL
LKSAQKLVSKTTPPAGFAGGRNDPTRVLSETFAPLLAVLPPETPAAGETPAAQNTASVSV
SNYLLQVSQTRLQLMQVANASDPQAMAQSLVKSAFSNSDTTLSQGRHYAQLLAASLGGEW
SSFADAAFVQPLEQAWNGVMTPAQQGINSAWQVQVQNPWQAEFTGRYPFDNTKNDADFTQ
LAHYLTPDTGLIDQFITRQLAGVLEKQGDSWVPDPLNTQGMSINPDFLSAVNQLSQLGRR
VFPQGKPGVTFELQIRPTRNVVETDLQIDDATLKYFNQLPGWQTFRWPDAASDHPQVSLT
YSPVAASGKSADAFQSYFQADGGWAWLRLLDKAQVEQLDSSRYRLSWQTATKETLNVVLR
TQSGGGPLELLTLRRFKLPAQIFTSPDLSTENAEDTTRHDAR
NT seq 3369 nt   +upstreamnt  +downstreamnt
atgactaaaagccttcacctgatgctggtggtgatgctcgccctggccctgagccttctg
tggctgaacgccgacggagaaaccctcacccacggcgtggcctggtgggcaaccggcgtc
atcctgctgagctattttctgctggcccgctacgccttcgccctggaattgctcgatttt
aaccgcccgcccgaggcacaggacgacgcgcgcatcacggcgtttgacaccctgcgtttc
accctgcgtcaccgctatggctggcactggaagcacaaacagccatggcttttggtcacc
ggtgaggcggcggtggtggaaaaagtcgcccccggcctgacgcaggcgcgctggcaggaa
agccagaatgccgtccttatctggtgtggcgaggctgacgcgctggatttagccgccgtc
acgcagctgcgcgacatgcgcgggcgccgcgcctttaacgccgtgctgtgggtcaccgat
gtgacggctgcgccggaatacctgtggactacgcagccggtgcctaatcagaccctgccg
gccggcaacagcgacaccgtctatcggcagtttatcgcgctcgggcacaccctcagctgg
cgtccgccggtgtttggcgtgtgcctgagtgagccgcagtgggaacaggacgaccgcccg
gtgcagagtatcggctgccactggccggcgggcacgccggtctcacttgatgaccagctc
agtcagcttgccgccacgctcatcccgcagggcgttgcgcagctgagcgagaacaaacac
tgggcctggctgctgcagctgtcaggggatctgaaacaccacaccggcgcgttgctcagg
cagcgttttcagccgtggctcggtgagcatcagcgcgtactggccggcggcatcttcttt
atgcctgctgcccctgaaccggcttctgttcagcaacgctcccacgcctgctatttgtcc
cccgcctggaacggcgttatcgcgcaaagccggacgcagcagggtcgccgcgaccacctg
tccaccggtgacaaactggccatcggcacgctgacgctggcggggctgtgggtactcggc
atgggaatatctgcctgtgccaaccgcacgcttatcgccgacagccaggcactgctgcag
gcggcccgcacgccggccccgatgtccgacacgctgacccgcagcgtagccctgcaggac
aacattgaccgcctgctgtggtggcagcaaaacggctcgccgtggctgcaccgcttcggt
ctcgatcagcgcgacgcggtgatcgaagcactgtggcccgcctatacccggcaaagtcag
gcgctgctgttaacgcctatggttaacgcgctgaaagaccggctgcaggcgtttgtgtcc
ctgccgccaggctctgccgaacgacgtctggccgggaaactggcctatcagcagctgaaa
gcctacctgatgctgctgcatcctgaacacgccgacccggcctttatgcaaccggtgctg
tctcctctgtggacggtgccggacggcgtggctcccggagaatggctggcccgttcagac
aaactgctcggcttttatctgcagcaactgccgcgccatctgcagtggaagctgcccgcc
gatgaccagttggtggccaacgtgcgtaccatcctgcgcagtcagaaaggcatcagcaac
agcgaaaacgcgctgtatcagcaggtgttgctgagcgtgtcgccgcactatgccgacgtc
acgctcgacagcctgctcggggaaaccgccggcggtcagctgttctccaccgatgacaac
ctgccgggcatgttcacccgtgaagcctgggagggggaagtcagcgacgcgattgataaa
gcggctgcggcacgccacgtcacctccgactgggtgctggatgataaaggcgaacaacag
ctgctgaccaaagaccagctgcagtaccgcctgaccgaacgctactttgccgattacacc
agcgcctggctcaatttcctcaacagcatccgctggaacaccagcgactcgctgagcacc
tccctcgatcagctgacccagctggccgatgcccgccagtcgccgctgctggccctgagc
cgcaccctacgttatcagggcgcggccggtcagcaccgcgaagcgatgggggactccctg
ctgaaatcggcacaaaagctggtgtcgaaaaccacgccgcccgccggattcgccggcggg
cgcaatgacccgacccgcgtgctgagcgagaccttcgccccgctgctggccgtgttaccg
ccggaaaccccggcggcaggtgaaacgcctgctgcacagaataccgccagcgtctccgtc
agcaactacctgctgcaggtgtcacaaacgcgattacagctgatgcaggtggccaatgcc
tccgacccgcaggcgatggcacaaagcctggtcaaatccgccttcagcaacagcgacacc
acgctgtcgcagggccgtcactacgcgcagcttctggcagccagcctgggtggcgaatgg
agcagctttgccgacgctgcgtttgtccagccgctggaacaggcgtggaacggcgtgatg
actccggcacagcaggggatcaacagcgcctggcaggttcaggtgcagaacccgtggcag
gcggaatttaccggacgctacccgttcgataacaccaaaaatgacgccgacttcacccaa
ctggctcactacctgacgccggataccggcctgattgaccagtttattacccggcaactg
gccggcgtgctggaaaagcagggtgacagctgggtacctgacccgctcaacacccaggga
atgagcatcaacccggacttcctcagcgcggttaaccagctgagccaactcggccgccgc
gtcttcccgcagggtaaacccggcgtgacctttgagctccagatccgcccgacccgcaac
gtagtcgaaactgacctgcagatagacgatgccaccctgaagtactttaaccagctgccg
ggctggcagacgttccgctggccagacgccgcaagcgatcacccgcaggtgtccctgacg
tactcaccggtcgcggcatcagggaaaagcgccgacgccttccagagctattttcaggcg
gacggcggctgggcctggctgcgtttactcgataaggcgcaggttgaacagctcgacagc
agccgctatcgcctgagctggcaaaccgccaccaaagagacgctaaacgtggtgttacgc
acccaaagcggcggcggcccgctggaactgcttaccctgcgacgctttaagctgccggcc
caaatatttacctctccggacctgtccacggaaaatgcggaggacacaacgcgccatgac
gcccgataa

DBGET integrated database retrieval system