KEGG   Rahnella sp. Y9602: Rahaq_4803
Entry
Rahaq_4803        CDS       T01422                                 

Definition
(GenBank) hypothetical protein
Organism
rah  Rahnella sp. Y9602
SSDB
Motif
Pfam: PAAR_motif VirK
Other DBs
NCBI-ProteinID: ADW76382
UniProt: A0A0H3FGE2
Position
pRAHAQ01:complement(376010..376264)
AA seq 84 aa
MRGVIRLDDPHTHGGKVSSASGAIFEGKPVMLAGDTVSCSQHGTVPVNQGHPTWKMNGKA
VIVDGCVAQCGCTLKTTLPNAGAQ
NT seq 255 nt   +upstreamnt  +downstreamnt
atgcgcggagtcattcgcttagacgatccccatacccacggcggcaaagtcagctcagcg
tcaggtgccatctttgagggtaaaccggttatgttagccggtgataccgtcagctgctct
cagcatggcactgtaccggtaaatcaggggcatccgacctggaaaatgaacggcaaagcc
gtgattgtggacggttgtgttgcgcagtgtggttgcactctcaaaacaaccctgccgaac
gccggagcgcaatga

DBGET integrated database retrieval system