KEGG   Rahnella sp. Y9602: Rahaq_4808
Entry
Rahaq_4808        CDS       T01422                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
rah  Rahnella sp. Y9602
Pathway
rah03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rah00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rahaq_4808
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rah02044]
    Rahaq_4808
Secretion system [BR:rah02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq_4808
SSDB
Motif
Pfam: DUF2345 Phage_GPD T6SS_Vgr Phage_base_V Sarcoglycan_1 BNR_3
Other DBs
NCBI-ProteinID: ADW76387
UniProt: A0A0H3FGE7
Position
pRAHAQ01:complement(380509..383016)
AA seq 835 aa
MSIQEYILAGSKLPIHNHYQLRLKRLESQQPGVDISVLKFSGSEAISDILRYEIEFTSAV
KDIPARHIINYTALFLMYPDGKPWESVKPRIIPGVITQFRQCSTSADETRYVATLEHRVT
RLNQGSNNAIYQNDSVISMTENTFLRYNMDRLDFRFALNDQYPLKKFMMQFGESEYAHIA
RRLADSGISYFFEYDEENNCDVMVLADHSYAWPESVAIPFRNPAGMFDGGLESVWDMSVS
RKSIPKSVTVNDDYYPAAQSDMTGTAETNPDYPALVAEDYRWGEYYPEPGKEFSNEPGQG
MWYTKRRQERYLSEQVTFEGKSNCMTLRPGMVITTPDKDWPEALDGLLIVSTNSKNVARD
TAYFVTFTAVPRNTQHPYRPALLPWPTVTGTLPARISSAHPDEPYAHINADGLYRAQFGF
DRTEWQKGFESCWLRLAKPYSGDTCGFHMPLLDSTGVAIAFENGDVDRPYIACALHDSTH
PDHVALPNYKRNVIRTPSGNKIRLEDQRGKEHIKISTVHSGKSQLSLGHLVDSARKQRGE
GAELRTDAYVAVRGGKGVLLSTEPKNSAQGQQLDMDAAIAQLEKALALAKTLKSTADIAQ
ASPAETTDQELLKTDLTKLAQPGVVVYGDAGIAHTTPKTIQQTAGKNLVATAGQDVSFSV
FRRFSVAAGELFSVFANKLGIKLIAAAGKVQLQAQKDQMELTSFEDMQITSTNGRIVLNA
KKELLLMCGGAGIRIKDGTIEELAPTRITQKSPVLEYQGGDSVKQAMPSFEEGKYAIQYR
LHAEDDPTQVLKNQKFRIHRQDGSITEGATDANGESSLLHMNELENAAIELIKGL
NT seq 2508 nt   +upstreamnt  +downstreamnt
atgagcattcaggaatatattcttgcaggcagtaaattaccgatccacaaccattaccag
ttgcgtcttaaaagactggaatcccaacagcccggcgttgatatttctgtgctcaaattc
agcggcagcgaggccatcagcgatattctgcgctatgagattgagtttaccagcgcggtg
aaagacattcccgcccggcacatcatcaactataccgccctgtttctgatgtaccccgac
ggcaagccgtgggaatcggttaagccacgcattatccccggtgtgatcacccagtttcgc
cagtgcagcacttctgctgatgaaacccgttacgtcgccacgctggagcaccgcgtcacc
cgcttaaatcagggcagcaacaacgcgatttaccagaacgacagcgtgatcagcatgacc
gaaaacaccttcctgcgttacaacatggaccggctggattttcggtttgcgctcaatgac
cagtacccgctgaaaaaattcatgatgcagtttggtgaaagcgaatacgcccatattgcg
cgacgcctggctgatagcggtatctcctacttcttcgaatatgacgaagagaacaactgc
gacgtgatggttctggcagaccattcatacgcctggcctgaatccgttgccatcccgttc
cgcaacccggcgggcatgtttgacggtggcctggaatcagtctgggacatgtcggttagc
cgtaaatcaatcccgaaatctgtcacggttaacgacgattactaccctgccgcgcaaagt
gatatgaccggcacagcggagaccaatcccgattatccggcgctggtcgccgaagattac
cgctggggtgagtactatcccgagccgggcaaggaattcagcaacgagcccggacagggc
atgtggtacaccaaacgccgtcaggaacgttaccttagtgagcaagtcacctttgagggc
aaatctaactgtatgacgctgcgtccggggatggtcatcaccacgcccgacaaagactgg
ccggaagcgctggacggtctcctgattgtctccacgaactctaaaaacgtcgcccgcgat
actgcgtatttcgtcaccttcaccgcggttccgcgtaatactcagcatccgtaccgccct
gcgttgttgccgtggccgaccgtcaccggcacgctgcctgcccgtatctccagcgcgcat
ccggacgaaccttacgcccacatcaacgccgacggtttgtaccgcgcccagtttggtttc
gaccgcaccgaatggcagaaaggctttgagagctgctggctacgtctggcgaaaccgtat
tccggtgatacctgcggcttccatatgccgctgctggattccaccggcgtggcgattgcc
ttcgaaaatggcgacgttgaccggccttatatcgcctgtgcgctgcatgattcaacgcac
ccggatcatgtggcgttaccgaattataagcggaacgtcatacgcactccttctggaaat
aagattcgacttgaggaccagcggggcaaagaacatataaaaatcagcacggtacattca
ggtaagagccagctcagtctgggacacttggtggacagtgccagaaagcaacgaggtgaa
ggcgcagaattgcgaactgatgcctatgttgccgttcgcggcggtaaaggcgtgctgctt
tctaccgagccgaagaacagtgctcagggacagcaactggatatggatgccgccattgcc
cagcttgaaaaagccctggctctggccaaaaccctgaagagtaccgccgatatcgctcag
gcgtctccggcagaaaccaccgatcaggagctgctcaagacagacctcaccaaactcgct
cagccaggtgtcgtcgtctatggcgatgccggtattgcgcacaccacgccgaaaacgatc
caacaaactgcaggtaagaatctggtggccaccgctggccaggatgtcagtttcagcgta
ttccgtcgcttctcagttgccgccggtgaactgttctccgtatttgcgaacaagttaggc
atcaagctcatcgccgctgcaggaaaggtgcagctacaggcgcaaaaagaccagatggag
ctgacctccttcgaggacatgcagatcaccagtaccaacggccgcatagtgcttaacgcc
aaaaaagagctgctgctgatgtgtggcggggctgggatccgcattaaggatggaacgatc
gaagaactggcaccgacccgtattacccaaaaatcaccggtactggagtatcagggtggg
gacagcgtgaagcaggcgatgccgtcatttgaagagggcaagtacgccattcagtatcgt
cttcatgctgaagatgacccgactcaggtgcttaaaaatcagaaattccgtatccaccgc
caggatggatccataaccgaaggggctacggatgccaacggcgaatcgtccttactccat
atgaacgaactggaaaatgcggcgattgagctaattaagggactatga

DBGET integrated database retrieval system