KEGG   Rahnella sp. Y9602: Rahaq_4929
Entry
Rahaq_4929        CDS       T01422                                 

Definition
(GenBank) Type IV / VI secretion system, DotU
  KO
K11892  type VI secretion system protein ImpK
Organism
rah  Rahnella sp. Y9602
Pathway
rah03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rah00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rahaq_4929
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rah02044]
    Rahaq_4929
Secretion system [BR:rah02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq_4929
SSDB
Motif
Pfam: DotU IMS
Other DBs
NCBI-ProteinID: ADW76504
UniProt: A0A0H3FH94
Position
pRAHAQ01:515370..515996
AA seq 208 aa
MMSLLNCYLPLFRYVTAFFINPQEYSDYREFREKIITLLQQALLESERHHEKAECDDAYF
AVVLWVDERVLRSRAEWVKEWRSNLLQKYYFDISVGGEAFFDRLDQTDKTNTQLRMVYLF
CLLMGFHGKYTSQDAQLLQQRIEDERQCLPQAWRQWPNNALLVEQDAGGGEKNKTVVKKL
RQRKGLLLALPVVVYLVILSTGLGIFFR
NT seq 627 nt   +upstreamnt  +downstreamnt
atgatgagtttgctcaattgttatttaccgctgtttcgctatgtgacggcgttttttatt
aatccgcaggaatattctgattacagagagtttcgcgaaaaaattattactttattacag
caggcgctgcttgagtcagaacgtcatcatgaaaaagcagagtgcgatgatgcttatttc
gcggtggtgctgtgggtagatgagcgggtattaagatcccgcgcggagtgggtgaaagaa
tggcgaagcaatctgttgcagaaatattattttgatatttctgtcggcggcgaggcattt
ttcgaccggctggatcaaaccgataaaaccaatacacaactgagaatggtgtatctgttc
tgtctgctgatgggcttccacggaaaatatacctcacaggatgcgcagcttttgcaacag
cgcatcgaggatgagcggcagtgcttgccacaagcctggcgtcagtggccgaacaatgcc
ttgctggttgaacaggacgcaggcggcggcgaaaaaaataaaacggtggtgaaaaaacta
cgccagcgtaaagggctgttactggcactgcctgttgtcgtctatttagtgattttgtcc
accggcttagggatatttttcaggtaa

DBGET integrated database retrieval system