KEGG   Rothia aeria: RA11412_0682Help
Entry
RA11412_0682      CDS       T05268                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
raj  Rothia aeria
Pathway
raj00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:raj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RA11412_0682
Enzymes [BR:raj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     RA11412_0682
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     RA11412_0682
    1.1.1.-  
     RA11412_0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AdoHcyase_NAD ADH_zinc_N_2 Pyr_redox NAD_binding_3 FAD_binding_3 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: BAV86981
UniProt: A0A2Z5QX82
Position
complement(606109..607194)
Genome map
AA seq 361 aa AA seqDB search
MKAARFYDRNDIRIEDIPAPKVAPGEVLVKVAWCGICGTDLHEYLDGPIFCPQHGHPHPI
SGEDSPVTMGHEFSGVVKELGEGVTDLEVGDHVVVEPYIIDDAVDVGPDSKTYHLSKNMN
FIGLAGRGGGLSEVVSVKRRWVHKISKNIPLDEAALIEPLTVGVHAVERAGEIHEGDYAL
VTGAGPIGLLTSAVLKAKGAKVIISELSPLRRQKALDSGVADYTFSPAETDVLAEIQKLT
NDRGVDIAFECTSVQPALDLILDAIKPTGKVVVVSIWGKPASLDVQKLVLKEIDLRGTIA
YVNNHPESIALVESGKLDLKPFITGKIALEDLIDKGFDTLINHNETAVKILVTTDPELLA
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctcgtttctatgaccgcaacgatattcgtatcgaagacatcccggccccc
aaagtagcccccggtgaagtactcgttaaggtcgcctggtgcggcatttgcggcaccgac
ctgcacgaatacctcgacggccccatcttctgcccccagcacgggcacccgcaccccatc
tcgggtgaggattcccccgtcaccatgggccacgagttctctggcgtcgtgaaagaactc
ggcgaaggcgtcaccgacctggaagtcggcgaccatgtggttgttgagccctacatcatt
gatgacgcagtggatgttggccccgactcaaagacctaccacctgtcaaagaacatgaac
tttattggcctggcaggccgtggcggcgggctctccgaagttgtgagcgtcaagcgccgc
tgggtccacaagatctccaagaacattccccttgacgaggcggcacttattgagccgctc
accgtgggtgtgcacgctgttgagcgcgccggcgaaatccatgagggcgattacgcgctg
gtgaccggcgcaggcccgatcggcctgctcacctccgcagtgcttaaggcaaagggcgct
aaggtcattatctccgagctgtcaccgctgcgtcgccagaaggcgctcgactccggggtt
gcagactacaccttctcccccgccgagaccgatgtgctcgctgaaattcagaagctcacc
aatgaccgtggcgtggatattgccttcgagtgcacctctgttcagcccgcgctcgatttg
atcctggatgccattaagcccaccggtaaggtcgtggtggtctccatctggggcaagcct
gcctcgctggatgtgcagaagctggtgctgaaagagatcgacctgcgcggcaccatcgcc
tacgtgaataaccaccccgagagcatcgctctcgtcgagtcgggcaagctcgatctgaag
ccgttcattaccggcaagatcgccctggaagacctgattgataagggcttcgacaccttg
attaaccacaacgagaccgctgtgaagatcctcgtcaccaccgacccggagctgctggca
cagtag

DBGET integrated database retrieval system