KEGG   Rickettsia akari: A1C_01295Help
Entry
A1C_01295         CDS       T00601                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rak  Rickettsia akari
Pathway
rak00020  Citrate cycle (TCA cycle)
rak00310  Lysine degradation
rak01100  Metabolic pathways
rak01110  Biosynthesis of secondary metabolites
rak01120  Microbial metabolism in diverse environments
rak01130  Biosynthesis of antibiotics
rak01200  Carbon metabolism
Module
rak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rak00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1C_01295
  Amino acid metabolism
   00310 Lysine degradation
    A1C_01295
Enzymes [BR:rak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     A1C_01295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABV74577
UniProt: A8GMF2
Position
complement(240318..241520)
Genome map
AA seq 400 aa AA seqDB search
MSVKIIVPLLGESVTEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS
KTDGANVAVGEEIGDINEGAAVNTAGTHTESAKAQEVTQPTSEKPVDRPAMVNNILAPSV
QKLVTENKLDPNNIKGTGKDARITKSDVLETINTKSAATSTTVNKTNEERVQRVRMSRLR
KTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHDVKLGFMSFFVKATIEA
LKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADQMGFAEVEKAIGTLAKK
AREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIH
PMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttaaaattatagtaccgttgcttggagagtccgtaacagaagcaactattgcc
aaatggtataagaaagaaggtgattcggttaaaaccgatgaattactgttagaaattgaa
accgaaaaagtgactttagaagttaatgctccttgtaacggtactataggtaaaatatcg
aaaactgatggtgcaaatgtagcagttggagaagaaataggagatataaatgaaggtgca
gctgttaatactgccggtactcatactgaatctgctaaagctcaagaagttacgcaacct
acttcagaaaagcctgtagacagacctgccatggttaataatattcttgctccttccgta
caaaaattagttaccgaaaataagcttgaccccaataatataaaaggaacaggtaaagat
gctagaattaccaaaagcgacgtgcttgaaacaataaacacaaagtctgctgctacttct
actacagtaaacaaaactaacgaagaaagagtacagcgtgttcgtatgtcacgcttacgt
aaaactattgcacagcgtttaaaagattcacaaaatacagcagctattttgactactttt
aatgaaatcgatatgtcaaaagtaattgcattgcgtaatcaatataaggaagagttcgag
aaaaagcacgatgtgaaacttggctttatgtcgttttttgttaaagcaacaattgaagct
ttaaagcttattccatcggtcaatgctgaaatagatggtgatgatttagtatataaaaat
tactatgatataggtgtagctgtcggaacagagcaaggacttgttgtaccggttgttagg
gatgccgatcaaatgggatttgctgaggtagaaaaagctataggaactttggctaaaaaa
gctcgtgagggtaaactttctatggctgatttgtcagggggaacattttcgatttctaac
ggaggcgtatatggctcattattatctacaccgattattaatcctcctcaatcaggtatt
ttaggattacataaaactgaggaaagagctgtagttatagacggtaaaattgaaatacat
ccgatgatgtatatagctttatcttacgatcatcgtataattgacggaaaagaaggagta
tcgttcttggtaaaaattaagcagcttattgagaaccctgagaagttactactgaatttg
taa

DBGET integrated database retrieval system