KEGG   Rickettsia akari: A1C_04615Help
Entry
A1C_04615         CDS       T00601                                 

Definition
(GenBank) Succinyl-CoA:3-ketoacid-coenzyme A transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
rak  Rickettsia akari
Pathway
rak00072  Synthesis and degradation of ketone bodies
rak00280  Valine, leucine and isoleucine degradation
rak00650  Butanoate metabolism
rak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A1C_04615
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    A1C_04615
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A1C_04615
Enzymes [BR:rak01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     A1C_04615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABV75189
UniProt: A8GP64
Position
834114..834335
Genome map
AA seq 73 aa AA seqDB search
MNRIYPSTEAALEGLLYDGMTIMSGGFGLCGIPENLINALLKSNIQNLTIISNNCGVDNF
GLVLLLQNKQIKK
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaatctatccttcgactgaagctgctcttgaaggacttctttatgacggcatg
actatcatgtcaggcggattcggtctatgtggtattcccgaaaatctaataaatgcactt
cttaaaagcaatattcaaaatttaactattataagcaataattgcggtgttgataatttt
ggacttgtgcttcttcttcaaaataaacaaataaaaaaatga

DBGET integrated database retrieval system