KEGG   Rickettsia akari: A1C_05820Help
Entry
A1C_05820         CDS       T00601                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rak  Rickettsia akari
Pathway
rak00071  Fatty acid degradation
rak00072  Synthesis and degradation of ketone bodies
rak00280  Valine, leucine and isoleucine degradation
rak00310  Lysine degradation
rak00362  Benzoate degradation
rak00380  Tryptophan metabolism
rak00620  Pyruvate metabolism
rak00630  Glyoxylate and dicarboxylate metabolism
rak00640  Propanoate metabolism
rak00650  Butanoate metabolism
rak00900  Terpenoid backbone biosynthesis
rak01100  Metabolic pathways
rak01110  Biosynthesis of secondary metabolites
rak01120  Microbial metabolism in diverse environments
rak01130  Biosynthesis of antibiotics
rak01200  Carbon metabolism
rak01212  Fatty acid metabolism
rak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A1C_05820
   00630 Glyoxylate and dicarboxylate metabolism
    A1C_05820
   00640 Propanoate metabolism
    A1C_05820
   00650 Butanoate metabolism
    A1C_05820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A1C_05820
   00072 Synthesis and degradation of ketone bodies
    A1C_05820
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A1C_05820
   00310 Lysine degradation
    A1C_05820
   00380 Tryptophan metabolism
    A1C_05820
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A1C_05820
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A1C_05820
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A1C_05820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rak04147]
    A1C_05820
Enzymes [BR:rak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A1C_05820
Exosome [BR:rak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A1C_05820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABV75399
UniProt: A8GPS4
Position
1031762..1032940
Genome map
AA seq 392 aa AA seqDB search
MIKPVYITYAKRTAFGSFMGSLSTTSAPMLAAPLIKDMIQNSKIDPALVGEVILGQVITG
GSGQNPARQTLIHAGIPKEVPGYTINKVCGSGLKSVALAANAIMTGDNEIVIAGGQENMS
LSMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENVSKQFNISRQEQDEFAL
SSHKKAAKAQLAGIFKDEILPIEVTVKKTTSLFKHDETIRPDTSLEILSKLCPAFDKNGV
VTAGNASSINDGAACLMVVSEEALKKHNLMPLARIVSYASAGVDPSIMCTAPVPASQKAL
SKAGWSVNDLEIIEVNEAFAAQSIYVNREMKWDMDKVNINGGAIAIGHPIGASGGRILIT
LIHSLRRAKAKKGLVTLCIGGGIGMAMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaccggtttatataacttatgcgaaaaggacggcgttcggctcgtttatgggt
agtcttagcacgacttcagcaccaatgctagctgctcctttaataaaagatatgatacaa
aacagcaaaatcgatccagctttagtaggtgaggtaatacttggacaagtaataacaggt
ggtagcgggcagaatccggcgaggcaaactctgattcatgcggggataccgaaagaagtg
ccgggttatacgattaataaagtatgtggctcaggtcttaaaagcgtagcacttgcagca
aatgcgattatgactggtgataatgagatagttatagcaggtgggcaggaaaatatgtcg
ctcagtatgcacggtagctatatcagagccggagctaaattcggcgatattaaaatggtt
gatctcatgcagtatgacggactaactgatgtattttcaggagtatttatgggaattact
gccgaaaatgtctcgaaacagtttaatattagtagacaagagcaagatgaatttgcttta
agttctcacaagaaagcagctaaagcacagctagccggaatttttaaagatgaaatttta
cctatcgaagtaacggttaaaaaaactactagtttgtttaaacatgatgaaacaatcaga
cctgatacaagccttgaaattctgagtaaattatgtcctgcttttgataaaaacggcgta
gttacggctggtaatgcttcttcaatcaatgacggtgcggcatgccttatggtagtttct
gaagaagcattgaaaaagcataatttgatgccgctagctcgtattgtttcttatgcttca
gccggtgttgatccaagtattatgtgtactgcccccgttcctgcctcccaaaaggcttta
agtaaagcaggttggagtgttaatgatttggaaattatcgaggttaatgaggcgtttgct
gctcaaagtatttatgtaaaccgtgaaatgaaatgggatatggataaggttaacataaat
ggcggtgcaatagccatcgggcatccgattggtgcaagcggtggacgtattcttataact
ctgatacactctttaagaagagctaaagctaaaaaaggcttagtcaccttatgtatcggc
ggaggtattggtatggctatgtgcgttgaagcagtttaa

DBGET integrated database retrieval system