KEGG   Ruminococcus albus: Rumal_2486Help
Entry
Rumal_2486        CDS       T01387                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ral  Ruminococcus albus
Pathway
ral00010  Glycolysis / Gluconeogenesis
ral00030  Pentose phosphate pathway
ral00051  Fructose and mannose metabolism
ral00052  Galactose metabolism
ral00680  Methane metabolism
ral01100  Metabolic pathways
ral01110  Biosynthesis of secondary metabolites
ral01120  Microbial metabolism in diverse environments
ral01130  Biosynthesis of antibiotics
ral01200  Carbon metabolism
ral01230  Biosynthesis of amino acids
ral03018  RNA degradation
Module
ral_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rumal_2486
   00030 Pentose phosphate pathway
    Rumal_2486
   00051 Fructose and mannose metabolism
    Rumal_2486
   00052 Galactose metabolism
    Rumal_2486
  Energy metabolism
   00680 Methane metabolism
    Rumal_2486
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Rumal_2486
Enzymes [BR:ral01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rumal_2486
Protein phosphatases and associated proteins [BR:ral01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Rumal_2486
Messenger RNA biogenesis [BR:ral03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Rumal_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat DUF4879
Motif
Other DBs
NCBI-ProteinID: ADU22966
UniProt: E6UEW7
Position
2803713..2804675
Genome map
AA seq 320 aa AA seqDB search
MAKKIGVLTSGGDAPGMNAAVRAVCRTALQRGMEVVGIERGYNGLLNGEIVEMNARTVSG
IIQRGGTCLYTARCPEFKTKEGVAKGAEKCREIGLDGIVVIGGDGSFRGAADLSSMGIPC
IGLPGTIDNDISCTEYTIGYDTAMNTAMEMIDKIKDTAQSHDRCSVVEVMGRNAGYIAVN
VGVAVGAEAVITPEKDYDLDAICTKIQNTMKSGKNHFVVVVAEGVGKTDEITKIISEKTG
VETRATILGHVQRGGSPTVRDRVVATQMGHHAVELLEKGIGNRVVGMKDNHVYDVDIQEA
LSMKKPFEEELYGILNETAF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaaatcggtgttctcacaagcggcggcgatgcgcccggaatgaacgctgct
gttagagcagtatgcagaacagctcttcagagaggcatggaagttgtaggtatagagcgc
ggatacaacggtctgctgaacggcgagatcgttgagatgaatgcaaggactgtatccggt
atcatccagagaggcggtacttgcctatatacagccagatgccctgagttcaagactaaa
gagggcgttgcaaagggtgctgagaagtgccgtgagatcggtctggacggcatcgttgtt
atcggcggtgacggatccttcagaggcgcagctgacctttcttcaatgggtatcccctgc
ataggtcttcccggaactatcgacaacgatatatcctgcactgagtataccatcggttat
gataccgctatgaacaccgctatggaaatgatcgacaagatcaaggatactgcacagtcc
cacgacagatgctctgttgttgaggtaatgggcagaaatgcaggttacatagctgtaaac
gttggtgttgctgtaggtgctgaggctgttatcactcctgagaaggactatgaccttgac
gctatctgcaccaagatccagaatacaatgaagagcggcaagaaccacttcgttgtagtt
gtagctgagggcgttggcaagaccgatgagatcactaagatcatcagcgagaagacaggc
gttgaaacaagagctactatcctcggtcacgttcagagaggcggctcccctaccgttcgt
gacagagttgttgcaacacagatgggtcaccacgctgttgaactgctcgagaagggtatc
ggcaacagagttgtcggcatgaaggataaccacgtatatgacgttgatatccaggaagca
ctgtccatgaagaagcctttcgaggaagaactttacggtatactgaacgaaactgcattc
tga

DBGET integrated database retrieval system