KEGG   Rickettsia amblyommatis GAT-30V: MCE_06825Help
Entry
MCE_06825         CDS       T01787                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ram  Rickettsia amblyommatis GAT-30V
Pathway
ram00450  Selenocompound metabolism
ram00970  Aminoacyl-tRNA biosynthesis
ram01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ram00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MCE_06825
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MCE_06825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ram01007]
    MCE_06825
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ram03016]
    MCE_06825
Enzymes [BR:ram01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MCE_06825
Amino acid related enzymes [BR:ram01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MCE_06825
Transfer RNA biogenesis [BR:ram03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MCE_06825
 Prokaryotic type
   Other AARSs
    MCE_06825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 Dpoe2NT
Motif
Other DBs
NCBI-ProteinID: AFC70161
UniProt: H8K346
Position
complement(1183922..1185448)
Genome map
AA seq 508 aa AA seqDB search
MNNTYYITTPIYYVNDVPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAA
INKNIDPQKFTDQTSENFRHLMTAMHISNDDFIRTTEHRHKEAVAVFWQKLLDNGTIYEG
LYEGWYAVRDEAFFDESELTSDGLAPTGAPVEWVKEPSYFFNLSKWQDKLLEFYEANPDF
IRPISRRNEVISFVKLGLKDLSVSRTTFNWGIKVSNNEKHIIYVWLDALANYISALGYPD
KQSNYGKFWPADLHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMAHGWWTNEGQKISKSL
GNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTS
FVYKNNDAKVPLLTQGVIDKIYELPILKTASKFVEQNILLMDKTEINKILENIINLAEEA
NIYIDSEAPWNLKKIDPDKTLEVLYALLEVLRYIAIMLLPFIPNAANKMLDQLGVNKEER
LFKHLIRDYTLTAGSNILEPTIIFPKFE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatacttactacattactacccctatatattacgttaacgatgttccccatatc
ggtcatgcttatactagcgttgcaagtgacgtcatcgctcgtttcatgcgactgcgaggt
ttcgatgtaatgtttttaacaggtactgacgaacatgggcagaaagtagaaaaagcagct
attaataaaaatattgacccacaaaaatttaccgatcaaacatccgagaattttcgtcat
ctgatgactgctatgcatatttccaatgatgattttatcagaacaacggaacacaggcat
aaagaagctgtagctgttttttggcagaaattactagataacggcactatttatgaaggt
ttgtatgaagggtggtatgcagtgcgagatgaggctttttttgatgagtcggaacttact
agtgacggtttagcaccgacgggtgctccagttgaatgggttaaagagcctagctatttc
tttaatctttcaaaatggcaggataaattgcttgagttttatgaagcaaaccctgatttt
atcagacctatatcaaggcgtaacgaagtaattagctttgttaaattgggtttaaaagat
ttatcggtatcgcgtactacttttaactggggaataaaagtgtcaaataatgaaaaacat
ataatttatgtttggcttgatgcactggctaattatatttcagcacttggttatcctgac
aaacaaagtaattacggtaagttttggccggctgatttacatgtagtcggtaaagatatc
ttgcgttttcatgccgtctattggcctgctttcttaatggctgcagaagttccgcttccg
aaaacaattatggctcatggctggtggacgaatgaggggcagaaaatctctaaatctctt
ggtaatacaattgatccgattaagttaattgatgaattcggtgttgatcaagttaggtat
tttctgatgcgtgaagtaacttttggtgcggacggcaattttgctcgtagtaatttaatt
acccgtattaatagcgagttgtcaaacaaaataggtaatttattacagcgtactacatct
tttgtttataagaataatgacgccaaagtgcctttgcttacgcaaggtgttatagataaa
atatatgagctaccgattttaaaaaccgcaagtaaatttgtcgagcagaatattttattg
atggacaaaacagagattaataaaattcttgaaaatattattaatttagccgaagaggca
aatatctatattgatagcgaagcaccctggaatttgaaaaaaatcgatccagataaaacg
ttagaagtgttatacgctttactagaagttttacgctatattgcgataatgcttctgcct
tttataccgaatgcagcaaataaaatgcttgatcagttaggggtaaataaagaagaacgt
ctatttaagcatttaatacgtgattatactttaacagcgggtagcaatattttagaacct
accataatatttccaaaatttgaatag

DBGET integrated database retrieval system