KEGG   Rickettsia amblyommatis GAT-30V: MCE_07270Help
Entry
MCE_07270         CDS       T01787                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ram  Rickettsia amblyommatis GAT-30V
Pathway
ram00071  Fatty acid degradation
ram00072  Synthesis and degradation of ketone bodies
ram00280  Valine, leucine and isoleucine degradation
ram00310  Lysine degradation
ram00362  Benzoate degradation
ram00380  Tryptophan metabolism
ram00620  Pyruvate metabolism
ram00630  Glyoxylate and dicarboxylate metabolism
ram00640  Propanoate metabolism
ram00650  Butanoate metabolism
ram00900  Terpenoid backbone biosynthesis
ram01100  Metabolic pathways
ram01110  Biosynthesis of secondary metabolites
ram01120  Microbial metabolism in diverse environments
ram01130  Biosynthesis of antibiotics
ram01200  Carbon metabolism
ram01212  Fatty acid metabolism
ram02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ram00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MCE_07270
   00630 Glyoxylate and dicarboxylate metabolism
    MCE_07270
   00640 Propanoate metabolism
    MCE_07270
   00650 Butanoate metabolism
    MCE_07270
  Lipid metabolism
   00071 Fatty acid degradation
    MCE_07270
   00072 Synthesis and degradation of ketone bodies
    MCE_07270
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCE_07270
   00310 Lysine degradation
    MCE_07270
   00380 Tryptophan metabolism
    MCE_07270
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MCE_07270
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCE_07270
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MCE_07270
Enzymes [BR:ram01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MCE_07270
Exosome [BR:ram04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCE_07270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFC70236
UniProt: H8K2W8
Position
complement(1261601..1262779)
Genome map
AA seq 392 aa AA seqDB search
MTKPVYITYAKRTAFGSFMGSLSTTAAPMLAAHLIKDILQNSKIDPALVGEVILGQVITG
GSGQNPARQTLIYAGIPKEVPGYTINKVCGSGLKSVALAANSIMTGDSEIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQQQDEFAL
SSHKKAAKAQLAGVFKDEILPIEVTIKKTTSLFDHDETVRPDTSLKILSKLRPAFDKNGV
VTVGNASSINDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPNIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDMEKVNINGGAIAIGHPIGASGGRVLIT
LIHGLLRAKAKKGLVTLCIGGGMGMAMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccggtttatataacttatgcgaaaaggactgctttcggctcgtttatgggt
agccttagtacaacagctgcacctatgcttgctgctcatttaataaaggatatactgcaa
aacagcaaaatcgatccagctttagtaggtgaggtaatccttggacaggtaataaccggc
ggtagcgggcagaatccggcgaggcaaactctgatttatgcgggaataccgaaagaagtg
ccgggctatacgattaataaagtatgcggctcaggtcttaaaagcgtagcacttgcagca
aattcaattatgacgggtgatagtgaaatagttatagcaggtgggcaggagaatatgtcg
ctcggtatgcacggtagctatatcagagcaggagctaaatttggtgatattaaaatggtt
gatctaatgcagtatgacggattaaccgatgtattttcaggagtatttatgggtattact
gccgaaaatatctcgaaacagtttaatattagcagacaacagcaggacgagtttgcctta
agctctcacaagaaagcagctaaagcacagttagcaggagtttttaaagatgaaatctta
cctatcgaagtaacgattaaaaaaactactagtttgtttgatcatgatgaaacagtaaga
cctgataccagccttaaaattttgagtaaattacgtcctgcttttgataaaaacggtgta
gttacggtgggtaatgcttcctctattaatgacggtgcggcatgtcttatggtagtttcc
gaagaagctttgaaaaagcataatttaacgccgctagctcgtattgtttcttatgcttca
gccggtgttgatccaaatattatgggtactgcccctgtgcctgcatccaaaaaagcttta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcatttgcc
gctcaaagtatttatgtaaaccgtgaaatgaaatgggatatggagaaggttaatattaac
ggtggagcaatagcaatcggtcatccgatcggggcaagcggcggacgtgtacttattact
ctgatacacggcttattaagagctaaagctaaaaaaggcttagttactctatgtatcggt
ggtggtatgggtatggctatgtgcgttgaagcggtttaa

DBGET integrated database retrieval system