KEGG   Rickettsia amblyommatis GAT-30V: MCE_08645Help
Entry
MCE_08645         CDS       T01787                                 

Definition
(GenBank) helicase RecD/TraA
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ram  Rickettsia amblyommatis GAT-30V
Pathway
ram03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ram00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    MCE_08645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ram03400]
    MCE_08645
Enzymes [BR:ram01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MCE_08645
DNA repair and recombination proteins [BR:ram03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MCE_08645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SH3_13
Motif
Other DBs
NCBI-ProteinID: AFC70446
UniProt: H8K6D5
Position
pMCE_3:17592..17939
Genome map
AA seq 115 aa AA seqDB search
MNNGILPDLAQTNKASDFYFIEAEHGKDIINKIIMMIRERIPKKFNLNPVNDIQLLCPMQ
RGGVGARSLNIELQKILNPNYRSGITKFGQIFAIGDKVIQTENNYDKEVYNGVMH
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatggtatcttgcctgatcttgcacagacaaacaaagcatcagatttttatttt
atagaagcagagcatggtaaagatatcattaataaaataattatgatgataagggaacgt
atccctaaaaagtttaatcttaatcctgtaaatgatatccaattactatgtcctatgcaa
agaggtggtgttggtgctagatcattaaatattgaattacaaaaaatacttaatcccaac
tatagaagcggcataactaaatttggtcagatttttgctattggcgataaagttatacaa
acagaaaataattatgacaaggaagtctataatggagtcatgcactaa

DBGET integrated database retrieval system