KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_1346Help
Entry
Riean_1346        CDS       T01363                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
ran00010  Glycolysis / Gluconeogenesis
ran00052  Galactose metabolism
ran00500  Starch and sucrose metabolism
ran00520  Amino sugar and nucleotide sugar metabolism
ran00521  Streptomycin biosynthesis
ran01100  Metabolic pathways
ran01110  Biosynthesis of secondary metabolites
ran01120  Microbial metabolism in diverse environments
ran01130  Biosynthesis of antibiotics
ran01200  Carbon metabolism
Module
ran_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Riean_1346
   00052 Galactose metabolism
    Riean_1346
   00500 Starch and sucrose metabolism
    Riean_1346
   00520 Amino sugar and nucleotide sugar metabolism
    Riean_1346
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Riean_1346
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Riean_1346
Enzymes [BR:ran01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Riean_1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N RuvC DEDD_Tnp_IS110 Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ADQ82503
UniProt: E4TCJ4
Position
1479040..1480005
Genome map
AA seq 321 aa AA seqDB search
MTVSDLSSRMALGIDIGGTDTKFGLVNHRGEILGKGRIKTDYDEIDDFINALYKEIEPIL
EQHNAKSQLEGIGIGAPNGNYYKGTIENAPNLKWKGIVPLAEKMTAKFGVQCKVTNDANA
AAYGEMMFGAARGMKDFIMITLGTGVGSGVIANGQLVYGHDGFAGELGHTIVKPGGRKHW
STGSEGSLEAYASATGIAITAKKMRAEFPESILNNYPEEQINAKTVHECALAGDPTAIEV
FRYTGQKLGEALANFVMFSSPEAILLFGGVIKAGDFILKPTRMHMERNLLPIFRGKVKLV
FSELDEADAAILGASSLVWEK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttcggatttgtctagccgtatggctttgggaatagatataggaggtactgat
actaagtttggtttagtaaatcatagaggagaaatcctaggaaagggtagaataaaaaca
gactatgatgagatagatgattttataaacgctctttataaagaaatagaacctatacta
gaacagcataatgctaaaagccaattagaaggtataggcataggagcgcctaatggcaac
tactataaaggcaccatagaaaatgcccccaaccttaaatggaaagggatagtgcctttg
gcagagaaaatgacagcaaagtttggtgtgcagtgtaaggtaaccaacgatgctaatgca
gcagcttatggcgaaatgatgtttggggccgcaagagggatgaaagattttatcatgata
actctaggcactggggtcgggagtggagttattgctaacggtcagctagtgtacggtcac
gatggttttgcgggggaactagggcataccatcgtaaagccagggggaagaaagcactgg
agcacaggctcggaagggagcttagaggcttacgcatctgcaacaggcattgcgataacg
gctaaaaagatgagggcggagtttccagaatctatacttaataactacccagaagaacag
attaacgctaaaacagtacacgagtgtgctttggcaggagaccctacggcaatagaagtt
tttagatatacggggcaaaagttgggggaagcattggctaattttgtaatgttctcttct
ccggaggctattttattatttggtggggttataaaggcaggagattttatcttaaaacca
acaaggatgcatatggagagaaatttgttacctatatttagaggtaaagtaaaattagtt
tttagcgaactagacgaagcagatgcagcgatattaggtgcgagttctctagtttgggag
aagtag

DBGET integrated database retrieval system