KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_1740Help
Entry
Riean_1740        CDS       T01363                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
ran00010  Glycolysis / Gluconeogenesis
ran00020  Citrate cycle (TCA cycle)
ran00620  Pyruvate metabolism
ran01100  Metabolic pathways
ran01110  Biosynthesis of secondary metabolites
ran01120  Microbial metabolism in diverse environments
ran01130  Biosynthesis of antibiotics
ran01200  Carbon metabolism
Module
ran_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Riean_1740
   00020 Citrate cycle (TCA cycle)
    Riean_1740
   00620 Pyruvate metabolism
    Riean_1740
Enzymes [BR:ran01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Riean_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADQ82895
UniProt: E4TDN6
Position
complement(1920129..1921727)
Genome map
AA seq 532 aa AA seqDB search
MAEIITMPRLSDTMTEGKVSKWHKQVGDAVKEGDILAEIETDKAVQDFESEVNGTLLYVG
VSEGNAAPVDTILAIIGKEGEDISGLVGGNQSTPQPASSENTSVENTVTEATSSVEIPKG
VEVINMPRLSDTMTEGKVAKWNKNVGDTVKEGDILAEIETDKAVQDFESEFNGTLLYQGV
GEGEAAEVDKILAIIGPAGTDVSAIVSNGGVVSKPQAQQEQSSVASSSKAENVSTSNASV
STDRVAISPLARKMAEEKGIDITNLKGSGENGRIVKKDIENYQPNATEQRSASVTPAAQV
AMNFVAGETTETPNSQVRNVIAKRLSESKFSAPHYYLMVEVNMDKAITARKEINSLPDTK
VSFNDMVIKATAMALRKHPQINSSWAGDKIIHHGSINIGVAVAIPDGLVVPVLKSADFMN
YSQISAGVKDMASRAKSKGLKANEMEGSTFSISNLGMFGIETFTSIINQPNSCILSVGAI
IEKPVVKDGQIVVGNTMKLSLACDHRVVDGATGAEFLQTLKTYLENPFALLV
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaataattacaatgcctcgcctttctgatacgatgacagaaggtaaggtttcc
aaatggcataagcaggttggagatgctgtaaaggaaggagatattcttgcagaaatagaa
acggataaagccgttcaagattttgaatcagaggttaacggaacactactttatgtaggt
gtaagtgaaggaaatgcagctcctgtggatactattttggcaattatagggaaagaaggc
gaagatatttcagggcttgtgggcggtaatcaaagtacacctcaaccagcttcatcagaa
aatacttctgtagaaaatacagtaacagaagctacgtcatcagtagagatacctaaaggt
gttgaggtaattaatatgcctcgtctgtctgatacaatgacagaaggtaaagtagctaaa
tggaataaaaatgtgggagatacagtaaaagaaggagatattttagctgaaatagaaaca
gataaagccgttcaagattttgaatcagaatttaacggaactcttttataccaaggtgta
ggagaaggagaagcagcagaagtagataaaatattagccattataggacctgctggaaca
gatgtttctgctatagtttctaatggcggagtggttagtaagcctcaagctcaacaagaa
cagtcaagtgtagcttctagctcaaaagcagaaaatgtttcaacatctaatgctagtgtt
tcaacagatagagtggctatttctccattggctagaaaaatggcagaggagaagggtata
gatattacaaatctaaaaggttctggagagaacggaagaatagtaaagaaagatatagaa
aactatcagccaaacgcaacagaacagcgttctgcttctgtaacgccagctgcacaagta
gctatgaattttgttgctggagaaactacagaaacacctaactctcaagttagaaatgta
atcgcaaaaagactttctgaaagtaagttttcagcacctcattactatttaatggtagag
gtgaatatggataaagccatcactgctagaaaggaaattaactcacttcctgacactaaa
gtatcgtttaacgatatggtgattaaggcgacagctatggctcttagaaagcacccccaa
atcaatagtagctgggcgggagataagattattcatcatggtagcatcaatattggcgtg
gcagtggctatcccagacggattagtagtacctgtattgaagagtgcagactttatgaat
tatagtcaaatttctgcaggagttaaagatatggcttctagagcaaaatctaaaggtctt
aaagctaacgaaatggaaggttctacattctcaatatccaaccttggaatgttcggaata
gaaacatttacttctattatcaatcaaccgaactcttgtatactttcggtaggtgctatt
atagagaagcctgtggttaaagacggacaaattgtagtgggcaatactatgaagttgtct
ttagcatgtgaccaccgtgtggtagatggtgctactggtgcagagtttttacaaacatta
aagacttacctagaaaatccgtttgcattattagtttaa

DBGET integrated database retrieval system