KEGG   Raoultella sp. X13: DSD31_05010Help
Entry
DSD31_05010       CDS       T05540                                 

Gene name
fucA
Definition
(GenBank) L-fuculose-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rao  Raoultella sp. X13
Pathway
rao00051  Fructose and mannose metabolism
rao01100  Metabolic pathways
rao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DSD31_05010 (fucA)
Enzymes [BR:rao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     DSD31_05010 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AXC28874
Position
1017612..1018259
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYDGGMLITPTGIPYEKLTESHIVWIDA
NGQHEQGKLPSSEWRFHMAAYQTRPDAQAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEFVAVALKNRKATLLQHHGLIACEENLEKALWLAHEVEVLAQL
YLSTLAIVDPVPVLDDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacggaacagactggcgcggcagattattgatacctgcctggaaatgacccggctg
gggctgaatcagggcaccgccgggaacgtaagcgtgcgttatgacgggggaatgctgatt
acgccgacgggtattccttatgaaaaacttactgaatctcacatcgtgtggatcgatgcc
aacggtcagcacgagcaggggaaactgccgtcgagcgagtggcgttttcatatggccgcc
taccagacccggcccgatgcacaggccgtggtgcataatcacgcggtgcactgcacggcg
gtatcgatcctcaatcgcccgatcccggcgatccactacatgattgctgctgccgggggg
aactccattccctgtgcgccatacgccacctttgggacccgcgagctgtcagagtttgtc
gccgtggcgttaaaaaaccgcaaagcgacgctgctgcagcaccatggcctgattgcctgc
gaagagaatctggaaaaagcgctgtggctggcgcatgaggtcgaggttctggcgcagctc
tatctcagtaccctggcgatcgtcgatcctgttccggtgctggacgacgaggccattgcc
atcgtactggaaaaattcaaaacctacgggttacgtatcgaagagtga

DBGET integrated database retrieval system