KEGG   Raoultella sp. X13: DSD31_17045Help
Entry
DSD31_17045       CDS       T05540                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rao  Raoultella sp. X13
Pathway
rao00260  Glycine, serine and threonine metabolism
rao01100  Metabolic pathways
rao01110  Biosynthesis of secondary metabolites
rao01120  Microbial metabolism in diverse environments
rao01130  Biosynthesis of antibiotics
rao01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DSD31_17045
Enzymes [BR:rao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DSD31_17045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AXC31055
Position
3591952..3592953
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSPAMLEAMMAAPVGDDVYGDDPTVNELQRYAAQLAGKEAALFLPTGTQ
ANLVGLLSHCQRGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAADGTLPLDKVAAKI
KPDDIHFAPTRLLSLENTHNGKVLPRDYLKEAWQFTRERNLALHVDGARIFNAVVEYDCE
LRDIARYCDSFTICLSKGLGTPVGSLLVGSHEYIRRATRWRKMVGGGMRQAGILAAAGLY
ALQNNVQRLKEDHDNAVWMAGQLSAIGADVTRHDTNMLFVRVGEEHAEALGAFMQQRGVL
INASPIVRLVTHLDVSRQQLTDVVGHWQAFLQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgatagatttacgcagtgataccgtaacccgcccatcacccgccatgctggaggcgatg
atggccgccccggtcggagacgacgtgtatggtgacgacccgacggtaaatgaacttcag
cgctacgccgcacagctggccggtaaagaagccgcgctgttcctgcccaccggtacccag
gctaatctggtcggcctgctgagccactgccaacgcggcgaagagtatatcgtcggccag
ggcgcgcataactatctgtatgaagcgggcggagcggcagtgctgggtagcattcagccg
cagccgatagacgccgccgccgacggcaccctgccgctggataaagttgccgcgaagatt
aaacctgacgatatccactttgccccaactcgcctgctgagccttgaaaacacccataat
ggtaaggttctgccgcgcgactatctcaaagaggcctggcaatttacccgcgagcgcaat
ctggcgctgcacgttgacggcgcgcgtatcttcaatgcggtcgtggaatacgattgtgag
ctgcgggatatcgcccggtattgcgattcttttactatctgtctttctaaaggattgggc
acgccggtcggctcgctgctggtcggtagccacgagtacattcgccgcgccacccgctgg
cggaaaatggtcggcggcggcatgcgccaggccggtattctggcggcggcaggcctttat
gccctgcaaaacaacgtccaacggttaaaagaggaccacgacaatgcggtgtggatggcc
gggcagctcagcgcaattggcgccgacgtgacccgacatgataccaacatgttgtttgtc
cgcgtgggggaagaacacgccgaagcgctgggcgcatttatgcagcagcgcggcgtgctg
atcaatgcctcgccgatcgtgcgcctggtgacccatctggatgtcagccgccagcagctt
acggacgtcgtcggccactggcaggcatttttgcaacgctaa

DBGET integrated database retrieval system