KEGG   Raoultella sp. X13: DSD31_21640Help
Entry
DSD31_21640       CDS       T05540                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
rao  Raoultella sp. X13
Brite
KEGG Orthology (KO) [BR:rao00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DSD31_21640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Pax2_C DUF4354
Motif
Other DBs
NCBI-ProteinID: AXC31891
Position
4549636..4550013
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCVQVQSVYIESQSSPEEERYVFAYTVTIRNLGRTQVQLLGRYWLITNGHGRET
EVQGEGVVGEQPHIPAGGEFQYTSGAVIETPLGTMQGHYEMIDVNGAPFSIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaattcgcctcgagtttgcgtgcaggtgcaaagcgtctatatcgaatcgcagtct
tccccggaagaagagcgctacgttttcgcttataccgtcacgattcgcaatctggggcgg
actcaggttcagcttcttggccgctactggcttatcaccaacggccacggtcgtgagact
gaagtgcagggtgaaggggttgtcggcgaacagccgcatattcccgcaggcggtgaattc
cagtataccagcggagccgtcattgaaacgccgctgggcaccatgcagggacattatgaa
atgatcgacgtgaacggcgcgccgttctcgatcgatatccctgttttccgtctcgcagta
ccaacgctcattcactaa

DBGET integrated database retrieval system