KEGG   Raoultella sp. X13: DSD31_24390Help
Entry
DSD31_24390       CDS       T05540                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rao  Raoultella sp. X13
Pathway
rao00620  Pyruvate metabolism
rao00630  Glyoxylate and dicarboxylate metabolism
rao01100  Metabolic pathways
rao01110  Biosynthesis of secondary metabolites
rao01120  Microbial metabolism in diverse environments
rao01200  Carbon metabolism
Module
rao_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DSD31_24390
   00630 Glyoxylate and dicarboxylate metabolism
    DSD31_24390
Enzymes [BR:rao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DSD31_24390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AXC32389
Position
complement(5114012..5115613)
Genome map
AA seq 533 aa AA seqDB search
MTQQATITDELAFGRPYGEQEKQILTPEAVEFLTELVSRFTPERNKLLAARIQQQQAIDA
GRLPDFISETASIRNGDWTIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLVCRVRGLHLPEKHVTWR
GESIPGSLFDFALYFFHNYKNLLAKGSGPYFYLPKTQAWQEAAWWSDVFSYTEDRFALPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHGDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDADRNRQVLAKVTADKELEAKNG
HDGTWIAHPGLADTAMAVFNQVLGERPNQLFVSREEDAPIAADQLLAPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLNDGTPVTKTLFR
QWLAEELMVIQEELGEHRYSSGRFDDAARLMEQITTSEELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacaggcgacaataactgacgaactggccttcggccggccatatggcgagcag
gaaaagcagattttaacgcctgaggcggtggagtttctgacggaactggtgagccggttt
acgcctgagcgcaataaactactggcggcgcgtattcagcaacagcaggcgattgacgca
ggaagactgcctgattttatttcggaaacagcttccattagaaatggtgactggacgatc
cgcggtattcccgccgatttacaggatcgtcgggtggaaatcaccggaccggtagagcgc
aaaatggtgattaacgccctcaatgccaacgtgaaagtctttatggcagattttgaggac
tcgctggcaccggactggaacaaagtcattgatggccagattaacctgcgcgatgcggta
aatggcaccatcagctacaccaatgaagccggcaagatttaccagctgaaacccgatccg
gcggtactggtatgccgcgtgcgcggcctgcatctgccggaaaagcatgttacgtggcgc
ggtgagtcgattcccggcagcctgtttgatttcgcgctctattttttccacaactacaaa
aacctgctggcaaaaggcagcggtccttacttctatctgccgaaaacccaggcctggcag
gaagcggcatggtggagcgatgtcttcagctacaccgaagatcgttttgcactgccgcgc
ggcacgatcaaggccacgctgttaattgaaaccctgccggcggtgttccagatggatgaa
attctgcatgcgctgcgggaccatatcgtcggtctgaactgcggacgctgggattacatt
ttcagctatatcaaaacattaaaaaaccatggcgaccgcgtcttacccgaccgtcaggtt
gtcacgatggataagccgttcctcagcgcctattcgcgtctgttgattaagacctgccat
aaacgcggcgcgttcgcgatggggggaatggcggcgtttatccccagcaaagatgctgac
cgtaaccgccaggtccttgccaaagttaccgcagataaagagctggaagcgaaaaatggc
cacgacggcacctggatcgcccatccggggctggcggataccgccatggcggtcttcaac
caggtcttgggcgaacgtcctaaccagctgttcgtcagccgggaagaagatgcgccgatc
gccgccgaccagctgctggcgccctgtgagggcgaacgtacggaagcggggatgcgcgcc
aatattcgcgtcgcggtgcagtatatcgaagcctggatctccggcaacggctgcgtcccg
atttacggtctgatggaagatgcggcgaccgccgaaatttcgcggacctccatctggcaa
tggattcaccatcagaaaaccctcaatgacggtacgccggtcaccaagacgctgttccgt
cagtggttggcggaagagctgatggtcattcaggaggagctcggcgaacaccgctacagc
agcggacgttttgacgatgccgctcgcctgatggaacagatcaccacctcagaggagtta
atcgacttcctgacgctgccgggctaccgcctgctggcgtaa

DBGET integrated database retrieval system