KEGG   Raoultella sp. X13: DSD31_25085Help
Entry
DSD31_25085       CDS       T05540                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
rao  Raoultella sp. X13
Pathway
rao00471  D-Glutamine and D-glutamate metabolism
rao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rao00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DSD31_25085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rao01011]
    DSD31_25085
Enzymes [BR:rao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     DSD31_25085
Peptidoglycan biosynthesis and degradation proteins [BR:rao01011]
 Precursor biosynthesis
  Racemase
   DSD31_25085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AXC32499
Position
complement(5253128..5253979)
Genome map
AA seq 283 aa AA seqDB search
MATKLQDENTTCLAATPSDPRPTVLVFDSGVGGLSVYHEIRQLLPNLHYIYAFDNVAFPY
GEKSEEFIVERVLEIVTAVQQRYPLALAVIACNTASTVSLPALREKFAFPVVGVVPAIKP
AARLTANGVVGLLATRGTVKRPYTRELISRFANECKIEMLGSAELVELAEAKLHGEPVPL
EELRRILRPWLRMAEPPDTVVLGCTHFPLLQEELQQVLPEGTRMIDSGAAIARRTVWLLE
HEAPDAKSSDPNMAYCMALTAETEQLLPVLQRYGFEKLEKLPL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaaactgcaggacgagaatactacttgtctggcagctacaccttctgatcca
cgtcccaccgtgctggtgtttgactccggcgtcggtgggttgtcggtttatcatgagatt
cggcagctgctgccgaatctgcattacatctacgctttcgataacgtggcttttccttac
ggggagaagagtgaagaattcatcgttgaacgcgtgctcgaaatcgtcactgccgttcaa
caacgttatccgctggcgctggccgtcattgcctgtaacaccgccagcacggtctctctt
cccgcccttcgtgaaaaattcgcctttcctgttgtgggcgtcgtcccggcgattaagcct
gcggcccgcttgacggcgaatggcgtcgtcggcctgctggcgacgcgcggtacggtcaaa
cgcccctatacgcgtgagctgatcagccgctttgcgaatgaatgcaaaatagagatgctg
ggctccgcggagctggtcgagctggcggaagcgaagctgcacggcgaaccggtcccgctg
gaggagttgcggcgtattctgcgcccgtggctgcgaatggcggagccgcctgatacggtg
gtgctgggctgcacgcattttcctcttttacaggaagagctgcagcaggtgctgccggaa
ggtacccggatgattgattccggtgctgcgattgctcgtcgtaccgtctggctgctggaa
catgaggcgccagatgcgaaatccagtgacccgaatatggcttattgcatggcgctgacg
gcagaaactgaacaacttttacccgttttacagcgttacggctttgagaagctcgaaaaa
ctgccactttaa

DBGET integrated database retrieval system