KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0570Help
Entry
Rahaq2_0570       CDS       T01770                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
KEGG Orthology (KO) [BR:raq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raq02044]
    Rahaq2_0570
Secretion system [BR:raq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq2_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: AEX50497
UniProt: H2ITP5
Position
complement(587776..588858)
Genome map
AA seq 360 aa AA seqDB search
MEREPQPVYSRLIRDMGDKLPYTNFYRFCQLIEQSSPRRPPLGSTSSPKDDLIRFRPHPG
MGFPVSELKALECDRDHPERPPTVRTTFLGLYGVDSPLPTSYLDDIAQRREGHEAVEEFL
DIFNHRIMTQFYRVWRKYSYPASFEAGGTDETSQRLLGLMGLGIPGTAKNIATPVSRFLA
LLSNMRMPTRTAEGVIALVDLLSSETTASVRLHYPRTIAIKPLRFGDKTPLGLRPVLGHS
AKEVNSMFELQLYTENPAEAQAWLPGGQLSEDLLVLLRVYLGWRVDARILLTLPRHILPP
ARLHTSSDGGFRGQLGYTTVMRSASTSSEVPLNATLTIRLSDYQGLKPNLKTREVINVCF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagaaccacagccagtatattcccggctgatacgggatatgggcgacaaattg
ccttacaccaacttttaccgattttgtcagttgattgaacaatcctccccccgacgcccg
ccgcttggcagtaccagttccccgaaagatgatctgatacgttttcgcccccatccgggc
atgggctttccggtcagtgagttaaaagcacttgagtgcgatcgggatcaccctgaacgt
cctcccaccgtcagaaccactttcctggggttgtatggcgtcgactcccctctgcccacc
agctacctggatgatatcgctcagcgccgtgaaggacatgaagcagtcgaggaatttctg
gatatctttaatcaccgcatcatgacccagttctatcgggtatggcgaaaatactcatat
ccggccagcttcgaggcgggaggcaccgatgagacatcacagcgcctgctcggactcatg
ggtctgggcattccggggacagcgaaaaacattgccactccggtgtcccgctttctggca
ttactcagcaatatgcggatgccaacccgtacggcggaaggtgtcatcgcactggttgat
ttgttgtcttcagagacaacagccagcgttcgtcttcactatccgcgcacaattgccatt
aagccactgcgttttggtgataaaacgccgctgggcctgcggccggtgctcggtcattca
gccaaagaggtcaacagtatgttcgaactgcaactctatacggaaaatccggcagaggcg
caggcgtggttgccgggaggtcagttatcggaggatttactcgttttgttacgggtatat
ctgggatggcgggttgatgcccgtattctgctgacgctgccgcgtcacatcctgcccccc
gcccgattacacacctcttctgacggtggattcagagggcaactgggttacaccaccgtc
atgcgttccgcatccacatcatctgaagtcccgctgaacgccaccctcaccatccggttg
agtgactatcaggggctgaagcccaatcttaagacccgtgaggtgataaatgtctgcttt
taa

DBGET integrated database retrieval system