KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0579
Entry
Rahaq2_0579       CDS       T01770                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:raq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rahaq2_0579
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raq02044]
    Rahaq2_0579
Secretion system [BR:raq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq2_0579
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1
Other DBs
NCBI-ProteinID: AEX50506
UniProt: H2ITQ4
Position
complement(601529..603901)
AA seq 790 aa
MDIASSTPLNIVSSLNRYQLAVHNSTAPLDVESFVAREHLSRAYRYVVDVTSVIQDIDPQ
TILMQDASFIMQSLPATAFNIFTPPQVQRTVHGVITQFARLSESRDEAHYRLTLEPHLVL
LDHTRRCAIYQNMSVPEIVEKILRDNHRYQGWQFEFRLSQSYPRRELVTQWQLSDFDFIR
RLLSEVGIWFTFEMDNRLREEVVIFGDAQQYYQFDVKLPVKDVSGMNDNAAESVWSLSAL
HQIVESAVRVKDYNYRDAANTLTVENSVVSEDKTTTGNIYHYAEGFLKTGGVQKPEPDSA
GFYAFLRHERDLNDQHQLWGKTNATRLAPGQMLEIDGIIPKAYGKGILITGTVARASRST
SYQVTFTGIPYSETVGFRPALRARPKIIGTLPARITSISPNDIYSHIDKDGRYRLNFNFD
LDTWKDGYESPWIRLARAYAGDTYGLHLVLLAGTEVAVAFDGGHPDKPYIAHALHDSRHP
DHVTIENYKRNVLRTPANNKLRLDDERGKEHVKVATEYGKSQVSIGHLVDNKKEQRGEGF
ELRTDHWGAIRAAKGIFISADGQLQAQGKVLDMHEALDELEAAHREAISLHTAAKMAKAE
LADIEKQASLMNDTLKQLQQRALLLSAPAGIAQVTPASLQLSAGENLIATAGKNADISIA
QKLRIASGEILSLFAKAMGIKMFAAAGRIQIQAQSDALDMFSKKDMSIASSDGKVTVSAK
TELLLECGGGFIRIKGGNVEIGGPGSVSVKSATLQKVGPDSQNASLKLPEHCASMIDEAA
AGQGPTVSLS
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggatattgcctcctcaacgccactgaacattgtcagctccctaaaccgctatcagctc
gccgtacacaacagtactgcccccctcgatgttgagtcttttgtcgccagagaacatctg
agccgggcctaccgttatgtcgtcgacgtcaccagcgtgattcaggacatcgatccgcag
actattctgatgcaggacgcctcgttcatcatgcaatccttaccggccacagcattcaat
attttcacgccgccacaggtacaacgcacggtgcacggcgttatcactcagtttgcccgc
ttgtcagaatcccgcgatgaagcacactaccgcctgacccttgaaccacatttggtcctg
ctcgaccacacacgccgctgcgccatttatcagaacatgtcagtaccggaaatcgttgaa
aaaatcttgcgggataatcaccgttatcagggctggcagtttgagtttcgtctgagccag
agttatccgcgtcgtgagttagtcacccagtggcaactgtccgatttcgactttatccgc
cgcctgctttccgaagtggggatctggtttactttcgaaatggacaaccgcctcagggaa
gaagtggtgatatttggcgatgcccagcagtactaccagtttgatgtcaaactgccggtg
aaagatgtctcgggcatgaacgataacgccgcagagtccgtctggtctttgtcagcactg
catcagatcgtcgaaagtgccgtcagggtaaaggattacaactatcgcgatgcagcaaat
acgctgacggtggaaaacagtgtggtgtcagaggataaaaccaccactggcaatatttat
cactatgccgaaggctttctgaaaacaggcggcgtacagaaaccagaaccggacagcgcc
gggttttatgcctttctgcgccatgaacgtgacctgaacgatcagcatcagctatggggt
aaaaccaacgctacccgactggcaccggggcaaatgttagaaatcgacggcattattccg
aaggcctacgggaaaggcattctgatcaccggaaccgttgcccgcgcatcacgaagcacg
tcctatcaggtgactttcaccggcattccatacagtgaaaccgtcggatttcgtcctgcg
ttgcgggcgcgtccgaaaataatcggcaccttaccggcacgtatcaccagtatcagcccg
aacgacatctacagccatatcgataaagatggccgctatcgcctgaatttcaactttgac
ctcgatacctggaaagatggctatgaaagcccgtggatacgtctggcccgtgcctatgcc
ggggatacttacgggttacatctggttttgctggcagggacggaagtggctgtagccttc
gacggcgggcatcccgataagccgtatatcgctcatgcccttcacgactcccgccaccct
gatcatgtgactattgaaaactataaacgaaacgtactgcgcacgccggcaaacaacaaa
ctcaggctcgatgacgaacgcggtaaagagcatgtcaaagtcgccacggaatacggtaaa
agtcaggtcagtatcgggcacctggtggataacaagaaagaacagcgtggtgaagggttc
gaactgcgaacagatcactggggtgccatccgtgccgccaaaggtatttttatcagtgcc
gacggtcagcttcaggcgcagggaaaagttctcgatatgcatgaagcgcttgacgaactg
gaagcggcacatcgtgaagcgatcagccttcacaccgccgcgaaaatggccaaagcagag
ctggccgatatcgaaaaacaggccagcctgatgaatgacacgcttaaacaattacaacag
cgcgccctgcttctctctgcacccgccgggatcgcgcaagttaccccagccagcctgcaa
ctctccgccggtgaaaacctgattgccacagcaggcaagaatgccgatatcagcatcgcg
caaaaactgcgtatcgcctcaggggaaattctcagtctgttcgccaaagccatgggcatc
aaaatgtttgccgccgccggcaggatacagatccaggcgcaaagtgatgcactggatatg
ttctcgaagaaagacatgtcgatcgccagcagcgacggcaaagtgactgtttcagccaaa
accgaactgctgcttgaatgcggcggcggttttattcgcatcaaaggcggtaacgtggaa
atcggcgggccgggcagtgtgtcggtgaaaagtgccacgctgcaaaaagtcgggccggac
agccagaatgcatcgctgaaattaccggaacactgcgcttcgatgatagacgaagcggcg
gcgggtcagggaccgacggtaagcctgagttaa

DBGET integrated database retrieval system