KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_1208Help
Entry
Rahaq2_1208       CDS       T01770                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00010  Glycolysis / Gluconeogenesis
raq00052  Galactose metabolism
raq00500  Starch and sucrose metabolism
raq00520  Amino sugar and nucleotide sugar metabolism
raq00521  Streptomycin biosynthesis
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01120  Microbial metabolism in diverse environments
raq01130  Biosynthesis of antibiotics
raq01200  Carbon metabolism
Module
raq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
raq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq2_1208
   00052 Galactose metabolism
    Rahaq2_1208
   00500 Starch and sucrose metabolism
    Rahaq2_1208
   00520 Amino sugar and nucleotide sugar metabolism
    Rahaq2_1208
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rahaq2_1208
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Rahaq2_1208
Enzymes [BR:raq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rahaq2_1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEX51091
UniProt: H2J0J9
Position
1250576..1251541
Genome map
AA seq 321 aa AA seqDB search
MTKYSLVGDVGGTNCRLALCALDSGEISQSKTFSGLDYDSLEAVVREYLAQQHQDVEDAC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGLQHLEVINDFTAVSMAIPMLKEDDLLQFG
GKKAQDGKPAVIYGAGTGLGVAHLIHANNQWLSLPGEGGHVDFAPNSEEEDIILEQLRTE
LGHVSAERILSGPGLVNLYRAIVKSDNRVPENFRPKDVTELALTDENLDCRRALSLFCVI
MGRFGGNLALNMGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFKDYLMDIPVFLIT
HDQPGLLGAGAYLRQSIGMTI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagtactccctggtgggcgatgtcgggggcaccaactgccgcctggcgctttgc
gcgttggacagcggcgagatttctcagtctaagactttctccgggctggattacgacagc
ctcgaagccgtggtgcgtgagtacctcgcgcagcagcatcaggatgttgaagatgcctgt
attgccatcgcctgcccgatcaccggcgactgggtggccatgaccaaccatacgtgggcc
ttttccattgccgaaatgaagaaaaacctcggtctgcaacatctggaagtgatcaacgat
ttcactgccgtttctatggcaatcccgatgctgaaagaagatgacctgttgcagttcggc
ggtaaaaaagcgcaggacggcaaaccggcagtcatttacggtgcgggcaccgggctgggc
gtggcgcacttaatccatgccaataaccaatggctgagcctgccgggcgagggcggtcac
gttgatttcgcgccaaacagtgaagaagaagacatcattcttgagcagttgcgtaccgaa
ttgggacacgtttctgctgagcgtattctctccggtccgggcctggtgaatctctaccgt
gccatcgtcaaatcagataaccgcgtaccggaaaacttcagaccaaaagacgtgactgag
ctggcactgacggatgaaaatctggactgccgccgcgcactgtcactgttttgcgtcatc
atgggacgttttggcggcaatctggcgctgaacatggggaccttcggcggcgtatacatt
gcaggcggcatcgttccgcgcttcctggaattcttcaaagcctcgggctttcgcgccgcg
tttgaagataaaggtcgcttcaaagattacctgatggatattccggtattcctgatcacc
cacgatcaaccgggattactcggggcaggggcttatttgcgtcagtctatcggcatgaca
atctag

DBGET integrated database retrieval system