KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2089Help
Entry
Rahaq2_2089       CDS       T01770                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00730  Thiamine metabolism
raq00790  Folate biosynthesis
raq01100  Metabolic pathways
raq02020  Two-component system
Module
raq_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rahaq2_2089
   00790 Folate biosynthesis
    Rahaq2_2089
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rahaq2_2089
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:raq04147]
    Rahaq2_2089
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:raq00537]
    Rahaq2_2089
Enzymes [BR:raq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Rahaq2_2089
Exosome [BR:raq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rahaq2_2089
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:raq00537]
 Enzymes
  Rahaq2_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase PT-VENN Thioredoxin_7
Motif
Other DBs
NCBI-ProteinID: AEX51950
UniProt: H2IXS5
Position
complement(2194719..2196149)
Genome map
AA seq 476 aa AA seqDB search
MQQSVSLVARAITAALLLSASATTLAAETDTLTDRAAKGVLTEPGGARRLSGDQTAALKA
SLSDKTVKNVILLIGDGMGDSEITSARNYAEGAGGYFKGIDALPLTGQYTHYSLDKKTQK
PSYVTDSAASATAWATGVKSYNGAIGVDVNGKDHQTILEIAKAAGKATGNVSTAELQDAT
PAAQIAHVTSRKCYGPQETAEKCASNALENGGRGSITEQLLQARADVTLGGGRKSFSQLA
KAGEFQGKSLKEQALAQGYVWVENAEQLNAVTLADQKKPVLGLFSEGNMPVRWQGPKATY
HGNIDKPAVTCEANPQRTADIPTLAAMTEKAIDLLKANQNGFFLQVEGASIDKQDHAANP
CGQFGETVDLDEAVQKALEFARQDGNTLVIVTADHAHSSQIIETDAQAPGLTQTLTTKDG
APMTISYGNSEDDSQGHTGTQLRIAAFGPHAANVVGLTDQTDLFFTMRDAMAIKAQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaatccgtatctctggtcgcccgcgcaatcactgccgccctgctgctctccgct
tctgccaccaccctggccgctgaaactgacacgctgaccgatcgtgcggcaaaaggtgtg
ctgacggaaccgggcggtgcccgccgtctgagcggtgatcagaccgccgcgctgaaggct
tcactctcagacaagacagtgaaaaacgtgattttgctgattggcgacggcatgggtgat
tctgaaattacatctgcgcgtaactatgcagaaggcgcaggcggctatttcaaaggcatc
gacgccctgccgctgaccggccagtacacacactattctctcgataagaaaacgcagaaa
ccgagttatgtgactgattccgcagcatcagccaccgcctgggcaaccggcgttaaaagc
tataacggcgcgattggtgtggatgtaaacggcaaagatcaccagaccattcttgagatc
gccaaagctgcgggtaaagccaccggcaacgtctccactgctgaattacaggacgcaacc
cctgctgcgcaaatcgcccatgtgacctcacgcaaatgctacggcccgcaagaaacagca
gagaaatgcgccagcaacgcactggaaaacggcggacgcggttcgatcactgaacagtta
ttgcaagcccgcgcagacgtcacgctgggcggcggcagaaaatctttcagccaactggcg
aaagcgggtgagttccagggtaagtccctgaaagaacaagcgctggctcagggttatgtg
tgggtggaaaacgcagaacagctcaacgcggtcacgctggcagaccagaagaaaccggtt
cttggcctgttctctgaaggcaacatgccggtgcgctggcagggtccgaaagccacttat
cacggcaacattgataagcccgccgtcacctgcgaagccaatccgcagcgcaccgccgac
atcccgacacttgccgccatgacggaaaaagccatcgatttgctgaaagccaatcagaac
gggttcttcctgcaggttgaaggggcatcaattgacaaacaggatcacgccgctaatccg
tgcggacagttcggtgaaacggtggatctggatgaagccgtgcaaaaagcgctggagttc
gcccgtcaggacggcaatacgctggttatcgtcaccgccgaccacgcccattccagtcag
attatcgaaaccgatgcacaggctcccggcctgacgcagacgctgaccaccaaagacggt
gcgccgatgaccatcagttacggcaactcagaagatgattcgcagggacataccggcacg
caactgcgtattgcggcgtttggcccgcatgcagcgaatgttgtcggtctgaccgaccag
acggatttgttctttaccatgcgggatgccatggcgattaaagcgcaataa

DBGET integrated database retrieval system