KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2623Help
Entry
Rahaq2_2623       CDS       T01770                                 

Definition
(GenBank) glycerol dehydrogenase-like oxidoreductase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00561  Glycerolipid metabolism
raq00640  Propanoate metabolism
raq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Rahaq2_2623
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Rahaq2_2623
Enzymes [BR:raq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Rahaq2_2623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 PFK Polysacc_deac_2 PGM_PMM_I
Motif
Other DBs
NCBI-ProteinID: AEX52474
UniProt: H2IQV1
Position
complement(2813952..2815049)
Genome map
AA seq 365 aa AA seqDB search
MSKFIFSSPGKYVQGSGVLDELGDYLPDLGGKSFLIADDVVWGIIGDRVQKSLKKANVAF
HYERFNGEASASEITRLAGIARKAGTQVVVGLGGGKTLDTVKAIADELKQNVVIVPTVAS
TDAPCSALSVIYSDEGVFESYRFYNKNPDLVLVDTHVCAQAPVRLFASGIADGLATFVEA
QAVLRSHSRSMVGGDPTIAGMAIAEACEKTLLTYGYSAYTSVEQKLVTPAVEAVVEANTL
LSGLGFENAGLAGAHAIHNGFTAISGDIHHLTHGEKVAYGTLTQMVLEQRPDEEIAKYVR
FYRAIKIPTTLKEMHLENESFASLVKIGALAGGEGDTLGNLNHNLSAEDVANAILAVDAF
SKTVK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatttatcttttcttcgccaggaaaatacgttcagggcagtggtgtgctggat
gaattaggagattatctgccggatctgggcgggaaatcattcctgattgctgatgacgtt
gtttggggaattatcggtgaccgcgtgcagaagtcattgaaaaaagccaacgttgcattt
cactatgaacgctttaacggtgaagcctctgccagcgaaattacccgtctggccgggatt
gcccgcaaggcggggacccaggtcgtggtcggcctcggtggcggtaaaacgcttgatacc
gtgaaagcgattgctgatgaactgaaacaaaacgtggtgattgtgccgaccgtggcctct
accgatgcgccatgcagcgcgctttccgttatctattcagatgaaggcgttttcgaatct
taccgtttctacaataaaaacccggatctggtactggtagatacccatgtgtgcgctcag
gcgccggtacgcctgtttgcttcgggtatcgccgacggtctggcgacgtttgttgaggcg
caggctgtgctgcgttcacactctcgctcaatggtgggtggggatccgacgattgccggt
atggcgatagctgaggcctgcgagaaaacgctgctgacttacggctacagtgcgtatacc
tcggttgagcagaaactggtgacgccagccgtagaagcggtggtggaagctaacacgctg
ctttccggcctgggttttgagaatgccggtctggcgggcgcgcatgccatccataacggt
ttcaccgcgatttcaggtgacattcaccatctgacccacggcgaaaaagtggcctacggt
acgctgacacagatggtgctggaacagcgcccggacgaagaaatcgcgaaatacgtccgt
ttctaccgtgccattaaaatacccaccacgctgaaagaaatgcatctggaaaacgaatct
tttgccagtctggtgaaaatcggtgcgctggcaggcggcgagggcgatacgctgggtaac
ctgaaccacaatctttctgccgaagacgtggcgaacgccattctggcggtggatgcattc
agtaaaacggtgaagtaa

DBGET integrated database retrieval system