KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2944Help
Entry
Rahaq2_2944       CDS       T01770                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent, prokaryotic type
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00020  Citrate cycle (TCA cycle)
raq00480  Glutathione metabolism
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01120  Microbial metabolism in diverse environments
raq01130  Biosynthesis of antibiotics
raq01200  Carbon metabolism
raq01210  2-Oxocarboxylic acid metabolism
raq01230  Biosynthesis of amino acids
Module
raq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
raq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rahaq2_2944
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rahaq2_2944
Enzymes [BR:raq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Rahaq2_2944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AEX52770
UniProt: H2IU46
Position
complement(3166950..3168203)
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVIPNNPVIPFIEGDGIGVDVTPAMIKVVDAAVEKAYKG
ERKISWMEIYTGEKSVELYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYICLRPVRYYTGTPSPVKRPEDTDMVIFRENSEDIYAGIEWKAGSAEADKVIKFL
QDEMGVKKIRFPQDCGIGIKPCSEEGTKRLVRAAIEYTITNDRDSLTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKDIIIKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGSDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMEWFEAADLIVKGMEGAIANKTVTYDFERLMEGAKLRKCSEFADDMIANM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtggttccggctgaaggtaaaaagattacagtagacgctcagggt
aaactggtcattcctaataatcctgttatcccatttatcgaaggtgatggcatcggtgtt
gacgtgacgccggccatgatcaaagtcgttgatgcggctgttgagaaagcctataaaggc
gagcgtaaaatctcctggatggaaatctataccggcgagaaatccgtagaactgtacggc
aaagacgtctggttgccagaagaaaccctcgatctgatccgtgattatcgtgttgctatc
aaagggccactgactacgccagttggcggcggtattcgctccctgaacgtggcacttcgc
cagcaactcgacctgtacatctgtctgcgtccggtacgttattacaccggtacaccaagc
ccggttaaacgtcctgaagataccgacatggtgatcttccgcgaaaactccgaagatatc
tacgccggtattgaatggaaagccggttctgctgaagcggataaagtgatcaagttcctg
caagacgaaatgggcgtgaagaaaatccgtttcccacaagattgtggtatcggtatcaaa
ccttgctccgaagaaggcaccaaacgtctggttcgtgcggcgattgaatacaccatcacc
aacgaccgtgattcactgacgctggttcataaaggcaacatcatgaagttcaccgaaggt
gccttcaaggactggggctaccagctggcgcgtgaagagttcggtggtgagctgatcgac
ggcggtccttgggtgaaaatcaagaacccaaacaacggcaaagacatcatcattaaagac
gtgattgccgatgcattcctgcaacagatcctgctgcgtcctgctgaatacgacgtgatc
gcctgtatgaacctgaacggtgactacatttccgacgccctggcggcgcaggttggcggc
atcggtatcgcaccgggcgctaacatcggttctgattgcgcgctgtttgaagctactcac
ggtactgcaccgaaatatgccggtcaggacaaagtgaacccgggttcaatcatcctttcc
gcagaaatgatgctgcgtcatatggaatggttcgaagccgcagacctgatcgttaaaggc
atggaaggcgctatcgccaacaaaactgtgacttacgatttcgaacgtctgatggaaggc
gctaagctgcgcaaatgtagcgagtttgccgacgacatgatcgcaaatatgtaa

DBGET integrated database retrieval system