KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3893Help
Entry
Rahaq2_3893       CDS       T01770                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00260  Glycine, serine and threonine metabolism
raq00750  Vitamin B6 metabolism
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01120  Microbial metabolism in diverse environments
raq01230  Biosynthesis of amino acids
Module
raq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rahaq2_3893
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rahaq2_3893
Enzymes [BR:raq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rahaq2_3893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEX53674
UniProt: H2IRW8
Position
complement(4143676..4144965)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVKQGLGKQQGLFFPLELPEFELTEIDRLLELDFVTRSSRILS
AFIGDEIPEEALYQRVKNAFAFPAPVAKVEEDIACLELFHGPTLAFKDFGGRFMAQILTQ
VSGDQPVTILTATSGDTGAAVAHAFHGLKNVRVVILYPRGKISPLQEKLFCTLGGNIHTV
AIDGDFDACQALVKQAFDDEELKHALKLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLTDGEWQPKKTVATLSNA
MDVSQPNNWPRVEELYRRKTWQLKDLGFGAVSDDTTEDAMRELANIGYISEPHAAIAYRV
LRDQLQPGEFGLFIGTAHPAKFKESVEAILDQDIGLPKELADRADLPLLSHNLPADFSEI
RAFLMALPE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaacctgaaggatcacaacgagcaggtcagctttgctcaggccgtcaaa
caaggtcttggaaaacagcagggattgttcttcccgctggaattgcctgagtttgaactg
actgaaatcgaccgcttgctggaactggatttcgtcacccgcagcagccgtattctttct
gctttcatcggcgatgaaattccggaagaagcgttatatcagcgcgtgaaaaatgccttt
gccttcccggcaccggttgccaaagtggaagaagacattgcctgcctggagctgttccac
ggtccgactctggcctttaaagattttggtggccgcttcatggcgcagatcctgactcag
gtatcgggcgaccagccggtgaccattctgaccgcgacgtccggtgataccggcgcggca
gtagcgcatgccttccacggcctgaaaaatgttcgtgtggtgattctgtacccgcgcggc
aaaatcagtccgttacaggaaaaactgttctgcaccctgggtggcaacattcatactgtc
gccatcgacggtgactttgatgcctgtcaggcgctggtgaaacaggcgttcgatgatgaa
gaactgaaacacgcgctgaaactgaactcggcgaactccatcaatatcagccgcctgctg
gcgcagatttgttactactttgaagcggttgcccagcttccacaggaagcgcgcaatcag
ctggtggtttccgtgccaagcggtaactttggtgatttaacggcaggtctgctggcgaaa
tctctcggcctgccggtgaaacgctttattgctgcgaccaacgccaatgacaccgtgccg
cgttttctcactgacggcgagtggcaaccgaagaaaaccgttgcgaccctgtcgaacgcc
atggatgtcagccagcccaacaactggccgcgcgtggaagaactgtatcgtcgtaaaacc
tggcaactgaaagatctgggctttggcgcagtcagcgatgacaccaccgaagatgcgatg
cgtgagctggcaaatatcggttatatctctgaacctcacgcggcgattgcttaccgtgtg
ctgcgcgatcagttgcaaccgggtgaattcggcctgttcatcgggacggcgcatccggcg
aaattcaaggaaagcgtggaagcgattctggatcaggatatcggtttgccgaaagaactg
gctgatcgcgctgatctgccattgttgtcgcataaccttccggctgatttcagcgaaatc
cgcgcattcctgatggcgctgcctgaataa

DBGET integrated database retrieval system