KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4232Help
Entry
Rahaq2_4232       CDS       T01770                                 

Definition
(GenBank) Zn-finger containing NTP pyrophosphohydrolase
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00760  Nicotinate and nicotinamide metabolism
raq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rahaq2_4232
Enzymes [BR:raq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     Rahaq2_4232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX zf-NADH-PPase DUF1451 DZR zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: AEX53994
UniProt: H2IVT9
Position
complement(4504840..4505616)
Genome map
AA seq 258 aa AA seqDB search
MELQITEQHNGWWVISQEGKLWLPEGELPFGSAAQFSLTGKTARQIGEWQGEPVWLVRQA
MPNHMFSARQLLDQDRGLFQLVGRGVQLSEFYRSHQFCGYCGHEMHVSKTEWAALCGHCH
ERYYPQIAPCIIVAIRKGDEILLAQHVRHRNGIHTVLAGFVEVGETLEETVAREVMEESN
IRVKNVRYVSSQPWPFPNSLMMAFMADYDSGDIQHDPKELLNASWYRFDALPQLPPPGTI
ARRLIEDTVVLCRAEHEE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggaattacagattactgagcaacacaatggctggtgggtcatcagccaggaaggcaag
ctgtggctgcctgagggcgaattgccatttggcagcgctgcacaattttctctgaccggt
aaaacggcgcgtcagatcggcgaatggcagggtgaacctgtctggctggttcgccaggcg
atgccaaaccatatgttttccgcccgtcagttgctggatcaggatcgcggattattccag
ctggtcgggcgtggggtacagctgtcagaattttaccgatctcatcagttctgcggttac
tgcggacatgaaatgcacgtcagcaaaaccgagtgggcggcactctgcgggcactgtcat
gaacgctattatccgcagattgcgccctgcatcattgtggctatccgtaagggtgatgag
attttgctggcgcagcacgtccgccatcgtaatggtattcatacggtgctggcgggtttc
gtggaagtcggagaaaccctggaagaaactgtggcacgcgaagtgatggaagaaagtaac
attcgcgtgaaaaatgtccgttacgtcagttcacagccctggccattccccaattcgctg
atgatggcatttatggcggattacgacagcggcgacatacagcatgacccgaaagagttg
cttaacgcgagctggtatcgctttgatgcattgccgcagttgccgcctccggggacgatt
gcgcgccgtctgattgaagacaccgttgtcctttgtcgtgctgaacacgaagagtag

DBGET integrated database retrieval system