KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4233Help
Entry
Rahaq2_4233       CDS       T01770                                 

Definition
(GenBank) regulator of sigma D
  KO
K07740  regulator of sigma D
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
KEGG Orthology (KO) [BR:raq00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    Rahaq2_4233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rsd_AlgQ
Motif
Other DBs
NCBI-ProteinID: AEX53995
UniProt: H2IVU0
Position
4505716..4506231
Genome map
AA seq 171 aa AA seqDB search
MLNRLERLTQRVGGSNELVDQWLHARKELLVSYCTLVGLKPNKEKHTPLNEKALDNFCHN
LVDYLSAGHFHLYQRLIDEVEGANSPIKLQAAKIYPALELNTEAIMAFHDSYTENDIDDD
NAFAFHYALSDIGEALDARFQLEDQLITLAFDRSSHEEKPPANEEHLARPV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatcgtctggaaagactgacccaacgcgttggtggcagtaatgagttagtggat
caatggctgcacgcacgtaaagagctgctggtttcgtactgcactttggtcggcctgaaa
cccaataaagaaaaacatacccctctgaatgaaaaagcgttggataacttttgccataac
ctggtggactatctgtctgccggtcatttccatctgtatcagcggctcattgatgaagtc
gaaggtgcgaacagcccgataaaattgcaggctgcgaaaatataccctgcactggagctg
aatactgaagctatcatggctttccatgatagttacactgaaaatgatattgatgatgac
aatgcttttgcatttcattatgcattatccgatataggtgaagcgttagatgcccgtttt
cagctggaagatcaattgattactctggcgtttgatcgcagcagtcacgaagaaaagccg
cctgcgaatgaagaacatctcgccagaccggtttaa

DBGET integrated database retrieval system