KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4235Help
Entry
Rahaq2_4235       CDS       T01770                                 

Definition
(GenBank) thiamine biosynthesis protein ThiC
  KO
K03147  phosphomethylpyrimidine synthase [EC:4.1.99.17]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00730  Thiamine metabolism
raq01100  Metabolic pathways
Module
raq_M00127  Thiamine biosynthesis, AIR => thiamine-P/thiamine-2P
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rahaq2_4235
Enzymes [BR:raq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.17  phosphomethylpyrimidine synthase
     Rahaq2_4235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiC_Rad_SAM ThiC-associated
Motif
Other DBs
NCBI-ProteinID: AEX53997
UniProt: H2IVU2
Position
4506554..4508518
Genome map
AA seq 654 aa AA seqDB search
MSSTQKPVISEKKPSNRREQRAQAQSFIDSLQGEAFPNSRRIYLESDRQDIRVPMREIQL
SPTLVGGGKDNPQFEENEAIPVYDTAGPYGDPAAVIDVHTGLEKLRARWINERADTEELP
QVSSGFTQQRLADDGLDHLRFEHLPRPRKAIAGKNVTQLHYARKGIITPEMEFIAIRENM
GRERIRGEVLRQQHPGESFGAHLPTNITAEFVRQEVAAGRAIIPANINHPESEPMIIGRN
FLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLSTGRYIHETREWILRNSPVPI
GTVPIYQALEKVNGVAEDLNWEMFRDTLLEQAEQGVDYFTIHAGVLLRYVPMTAKRLTGI
VSRGGSIMAKWCLSHHRESFLFEHFREICEICAAYDVSLSLGDGLRPGSIQDANDEAQFA
ELRTLGELTKIAWEYDVQVMIEGPGHVPMQMIRRNMTEELEHCHEAPFYTLGPLTTDIAP
GYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKEDVKQGLITYKIAAHAADLAKGHP
GAQIRDNAMSKARFEFRWEDQFNLALDPATARAYHDETLPQESGKVAHFCSMCGPKFCSM
KITQEVRDYAATLEAKAQPVEIVESGMAQMSVEFHSRGSELYHPADKLSSEISK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtacccaaaaacccgttatttctgaaaagaaaccgtcaaaccgccgcgaacag
cgcgcgcaggcacagtcgtttatcgacagtctgcagggcgaggcctttcctaactcccga
cgtatttatcttgaatctgaccgccaggatatccgcgtgccaatgcgtgaaatccagctc
agcccgacgctggtcggcggcggtaaagacaatccgcagttcgaagaaaacgaagcgatt
cctgtttacgacaccgccgggccttacggcgatccggcggcggttatcgatgtgcatacc
ggtctggaaaaattacgcgcccgttggataaacgagcgtgcggacacggaagaactccca
caagtcagttccggttttacccagcagaggctggcggatgacgggctggatcacctccgc
ttcgaacacctgccgcgcccacgcaaagccattgcaggcaaaaatgtcacgcaactgcat
tacgcccgcaaaggcatcatcacgcctgagatggaatttatcgccattcgcgaaaatatg
gggcgtgaacggatccgtggcgaggttctgcgccagcaacatcccggggagagctttggt
gcgcatttgcccaccaatatcaccgcagagtttgtgcggcaggaagtcgctgccggtcgc
gcgattattcccgccaacatcaaccatcctgaatcagagccgatgatcatcgggcgcaat
ttcctggtgaaagtaaacgctaatatcggcaactcggcggtgacgtcttccatcgaagaa
gaagtcgagaaactggtgtggtccacacgctggggggctgacaccgtgatggatctctcc
accggccgttatatacatgaaacccgtgaatggatcctgcgtaatagcccggtaccgatc
ggcactgtgccaatttatcaggcactggaaaaagtgaatggcgtggccgaagatctgaac
tgggaaatgttccgcgatacgttgctggaacaggccgaacaaggtgtcgattacttcacc
attcacgccggggtattgctacgttacgtgccgatgaccgccaaacgtctgaccgggatt
gtgtcgcgcggcggttcgatcatggcgaaatggtgtctttcacatcatcgcgaaagtttc
ctgtttgagcatttccgcgaaatctgtgaaatctgcgccgcctatgatgtttcgctgtca
ctgggagacggcttgcgccctggctccattcaggatgccaacgacgaagcacaatttgcc
gaattacgtacgttaggggaactgaccaaaatcgcctgggaatatgatgttcaggtgatg
atcgaaggaccgggacatgtgccgatgcagatgatccgccgcaacatgaccgaagaactt
gaacattgccacgaagcgcccttctataccctcggcccgctgaccaccgatatcgcaccg
ggttacgaccatttcacctccggtattggtgccgcgatgatcggatggttcggctgtgcc
atgctttgttatgtcacgccgaaagagcatctcggcctgccgaacaaagaagatgttaaa
cagggtctcatcacctacaaaatcgccgcgcatgccgccgatttagcgaaaggacatccc
ggtgcccaaattcgcgacaacgccatgtcaaaagcacgtttcgaattccgctgggaagac
cagtttaatctggctctcgatcccgcaacagctcgtgcctatcacgatgaaacgctgcct
caggaatccggcaaagtggcacacttctgctcgatgtgcggtccgaaattctgctcaatg
aaaatcactcaggaagttcgcgattatgccgcaacgctcgaagccaaagcccagccggta
gaaattgttgaatccggtatggcacagatgtctgtcgaattccattcgcgcggcagcgag
ctttatcacccggccgataagctcagttcggagatcagcaaatga

DBGET integrated database retrieval system