KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4236Help
Entry
Rahaq2_4236       CDS       T01770                                 

Definition
(GenBank) thiamine-phosphate pyrophosphorylase
  KO
K00788  thiamine-phosphate pyrophosphorylase [EC:2.5.1.3]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00730  Thiamine metabolism
raq01100  Metabolic pathways
Module
raq_M00127  Thiamine biosynthesis, AIR => thiamine-P/thiamine-2P
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rahaq2_4236
Enzymes [BR:raq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.3  thiamine phosphate synthase
     Rahaq2_4236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMP-TENI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEX53998
UniProt: H2IVU3
Position
4508515..4509168
Genome map
AA seq 217 aa AA seqDB search
MNQSAQPFPAVPFHLGLYPVVDTVEWIARLLDAGVKTLQLRVKDLSDEEVEPAIIDAIAL
GKKYQARLFINDYWRLAVKHQAYGVHLGQEDLDTADLEAIRQAGLRLGVSTHDDTELARA
VAVNPSYIALGHIFPTQTKDMPSAPQGLAELTRHIKKLDGNFPTVAIGGISIDRAPSVLD
CGVGSIAVVSAITQAADWRAATAQLLALCASKVPEDA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtccgctcaaccctttcctgccgttccgttccacctcggtttatatccggtc
gtggataccgtggaatggatcgcccgcctgctggatgcgggcgttaaaacgttgcaatta
cgtgtgaaagatttgtctgatgaggaagtcgaaccggcaattattgacgctatcgcgctg
ggcaaaaaatatcaggcgcggttattcatcaacgattactggcgtctggcggtaaagcat
caggcttatggtgtgcatttaggtcaggaagatctggatactgctgatcttgaggcaatc
cgtcaggccggtttacggttgggtgtttccacgcatgatgacaccgaactggcacgcgct
gtcgccgtaaatccttcttatatcgcccttggtcatatcttcccgacgcagaccaaagat
atgccttcggcgccgcaagggctggcagaactcacccgacatattaagaagctcgatggc
aacttcccgacggtggccatcggcgggatcagcattgaccgcgcaccgtcggttctcgac
tgcggcgtcggcagcatagccgtcgtcagcgccattacgcaggcggcggactggcgtgca
gcaacggcacaactgctggccttatgcgccagtaaggtgccggaagatgcttaa

DBGET integrated database retrieval system