KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4239Help
Entry
Rahaq2_4239       CDS       T01770                                 

Definition
(GenBank) putative enzyme of thiazole biosynthesis
  KO
K03149  thiazole synthase [EC:2.8.1.10]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00730  Thiamine metabolism
raq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rahaq2_4239
Enzymes [BR:raq01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.10  thiazole synthase
     Rahaq2_4239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiG His_biosynth NanE HPIP FMN_dh NMO Glu_synthase IMPDH
Motif
Other DBs
NCBI-ProteinID: AEX54001
UniProt: H2IVU6
Position
4510109..4510888
Genome map
AA seq 259 aa AA seqDB search
MLKIADTTFTSHLFTGTGKFASPALMQQALEASGSQLVTMAMKRVDLRRGGDDILSPLQQ
LGVRLLPNTSGAKTAEEAIFAAQLAREALGTHWVKLEIHPDVKYLLPDAVETLKAAEILV
KQGFVVLPYCSADPVLCKRLEEAGCAAVMPLGAPIGSNQGLQTREFLQIIIEQARIPVVI
DAGIGAPSQAAEALEMGADAVLVNTAIAIAGDPVAMATAFRLAVQAGVIARQSGLGGRQQ
QASASSPLTGFLNTSQVLS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaattgctgataccacatttacgtcgcacctttttaccgggacgggaaaattc
gccagtccggcgttaatgcaacaagcgcttgaagcatccggctctcagctggtgaccatg
gcgatgaaacgcgtcgatctgcgtcgcggaggtgatgatattctgtcccctctgcaacag
ctcggcgtccgtttactgcccaacacatcgggtgctaaaacagctgaggaggccatattt
gctgcacagctggcaagagaagcactgggaacccactgggtgaaacttgaaattcatccc
gacgtaaaatatctgcttcccgatgccgttgaaaccttgaaagccgcagagattctggtg
aagcagggatttgttgttttgccatattgcagcgcggatccagtgctgtgtaaacgtctg
gaagaagcgggctgcgccgcagtgatgccgctgggcgcgccgatcggttccaatcagggg
ctgcaaacccgtgagtttctgcaaatcatcatcgagcaggcacgcattccggtcgttatt
gatgccggtattggcgcgccaagccaggccgctgaagcattggaaatgggagccgatgct
gtgctggtcaatacggcgattgccatcgcaggcgatccggtcgccatggcgacagcattc
cggctggcggttcaggccggtgtaatcgcccgtcaaagcggcctgggcggcagacagcag
caagccagcgcgtccagcccgctgaccggttttctcaatacctcgcaggtgttgtcatga

DBGET integrated database retrieval system