KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4263Help
Entry
Rahaq2_4263       CDS       T01770                                 

Definition
(GenBank) flavodoxin
  KO
K00230  menaquinone-dependent protoporphyrinogen oxidase [EC:1.3.5.3]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00860  Porphyrin and chlorophyll metabolism
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
Module
raq_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rahaq2_4263
Enzymes [BR:raq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.3  protoporphyrinogen IX dehydrogenase (menaquinone)
     Rahaq2_4263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_5 Flavodoxin_3 Flavodoxin_1 SEFIR Carn_acyltransf
Motif
Other DBs
NCBI-ProteinID: AEX54016
UniProt: H2IVW1
Position
complement(4536416..4536955)
Genome map
AA seq 179 aa AA seqDB search
MKALILYSSRDGQTHAIASYIANELKEKCSCDVVDLAHAERVDLKSYDQVMIGASIRYGH
FNPVLDKFVKKHAETLNRMPSAFFGVNLTARKPEKRTPQTNAYVRKFLLASPWEPAMCGV
FAGALRYPRYRWFDKVMIQLIMRMTGGETDTRKEVEYTDWQQVAKFAEDFGQISYKKSH
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttgatactctattcaagtcgtgacggacaaacgcatgctatcgcttcttat
atagcgaatgagctgaaagagaagtgcagctgcgatgtggtcgatctggctcatgcagaa
cgtgtcgatctgaaaagctatgaccaggtcatgattggtgcctctatacgttacggtcat
tttaatccggtgctggataaattcgttaaaaagcatgccgaaacattgaaccgcatgccg
tcggcatttttcggcgttaacctgaccgcgcgtaaacccgagaaacgtacgccgcagacg
aatgcctatgtgcgtaaattcctgctggcgtcaccgtgggagccggcaatgtgcggcgtc
tttgcgggtgcattacgttatcctcgctatcgctggttcgacaaggtgatgatccaactt
attatgcgtatgactggcggtgaaacggatacccgtaaagaagtcgagtataccgactgg
cagcaggtggctaaattcgctgaagattttgggcaaatatcgtataaaaaatcgcactaa

DBGET integrated database retrieval system