KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4267Help
Entry
Rahaq2_4267       CDS       T01770                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00071  Fatty acid degradation
raq00280  Valine, leucine and isoleucine degradation
raq00281  Geraniol degradation
raq00310  Lysine degradation
raq00362  Benzoate degradation
raq00380  Tryptophan metabolism
raq00410  beta-Alanine metabolism
raq00640  Propanoate metabolism
raq00650  Butanoate metabolism
raq00903  Limonene and pinene degradation
raq00930  Caprolactam degradation
raq01040  Biosynthesis of unsaturated fatty acids
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01120  Microbial metabolism in diverse environments
raq01130  Biosynthesis of antibiotics
raq01200  Carbon metabolism
raq01212  Fatty acid metabolism
Module
raq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Rahaq2_4267
   00650 Butanoate metabolism
    Rahaq2_4267
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rahaq2_4267
   01040 Biosynthesis of unsaturated fatty acids
    Rahaq2_4267
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rahaq2_4267
   00310 Lysine degradation
    Rahaq2_4267
   00380 Tryptophan metabolism
    Rahaq2_4267
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rahaq2_4267
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rahaq2_4267
   00281 Geraniol degradation
    Rahaq2_4267
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rahaq2_4267
   00930 Caprolactam degradation
    Rahaq2_4267
Enzymes [BR:raq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Rahaq2_4267
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rahaq2_4267
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Rahaq2_4267
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Rahaq2_4267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 ETF
Motif
Other DBs
NCBI-ProteinID: AEX54020
UniProt: H2IVW5
Position
4540599..4542791
Genome map
AA seq 730 aa AA seqDB search
MLYQGETLHLHWLDGGIAELVFDAPGSVNKLDTQTVASLGEAIAVLEKQSELKGLLLSSA
KPAFIVGADITEFLSLFNAPAEKLHEWLNFANSIFNRLEDLPVPTLSAISGYALGGGCEC
VLATDFRISTADARIGLPETSLGIMPGFGGSVRLPRLIGTDSALEIIAAGKNISGKEALK
IGLVDAVVDADKLRDAGITMLKNAVDGKLDWHNRRDPKRLPLKLSQIEAAMSFSVAKSMV
MQNAGKHYPAPMTAVITIEAAARLGRDEALQLETASFVPLAQSKEARALVSIFLNDQFVK
GKAKKLAQGSDKPAQAAVLGAGIMGGGIAYQSALKGVPVIMKDINDPSLTLGMSEAAKLL
NKQLERGKIDGLKMAKVLSTIHPTLDYSGIERASVVVEAVVENPKVKAAVLAEVESLLDA
DTVLASNTSTIPIDQLASSLKRPENFCGMHFFNPVHRMPLVEIVRGEKTSDKTISRIVSY
ALTMGKTPVVVNDCPGFFVNRVLFPYFSGFSLLLRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPDRMARDYRDAVDVLFDNRRFGQKNQLGFYRYSEDSKGKP
RKEIDEQAISLLSDNLKPAHADFSPQDIIARMMIPMINEVLRCFEEGIIASPAEADMALV
YGIGFPPFHGGPFRYLDTLGTAEYLKMTEQYAHLGPMYQAPAGLRAKAQTNESYYPVAAG
LENLSTGNQA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgaaacattacatctgcactggcttgacggcggtatcgcggagctg
gtgtttgatgctccaggctcggttaataagctcgatacccaaacggttgccagcctgggc
gaagcgattgcagtgcttgaaaagcagtctgagctgaaaggattgctgctgagctcggcc
aaacctgcgtttattgtcggcgcggatattactgagtttctgtccctgtttaacgcacca
gcagaaaaactgcatgagtggctgaatttcgccaacagcatttttaaccgtctggaagac
ctgccggtaccgacactttccgcaatcagcggttacgcgctgggcggcggttgtgaatgc
gtactggcgacggatttccgtatcagtaccgccgatgcgcgtattggcctgccggaaacc
agcttaggcatcatgccgggcttcggcggctcggtacgcctgccgcgtctgatcggcacc
gacagtgcgctggaaattatcgccgccgggaaaaatatcagcggaaaagaggccctgaaa
atcgggctggtggatgccgttgtagacgccgacaaactgcgcgatgcgggcattaccatg
ctgaaaaacgccgtcgacggaaaactggactggcataaccgccgtgatccgaaacgtctg
ccgctgaaactcagccagattgaagcggcgatgagcttcagcgtcgccaaaagcatggtc
atgcaaaatgccggtaaacactacccggcgccaatgactgccgtgataaccattgaagcg
gcggcgcgtcttggccgtgatgaagccctgcaactggaaaccgccagttttgtgccgctc
gcacaatccaaagaagcccgcgcgctggtcagcattttccttaacgatcagtttgtgaaa
ggcaaagccaaaaaactggcgcaaggcagtgataaaccggcgcaggctgcggtgctgggc
gcagggattatgggcggcgggatcgcttatcagtcggcgctgaaaggcgtgccggtgatc
atgaaagacatcaacgacccgtccctgacactcggcatgagcgaagcggccaagctactg
aacaaacaactcgaacgcggcaaaatcgacggtctgaaaatggcgaaagtgctgtcgacc
attcatccgacgctggattacagcggtatcgaacgtgcctccgtggtcgttgaagccgtg
gtcgagaatccaaaagtcaaagccgccgtcctggcggaagtggaatcgctgctcgatgcc
gataccgtgctggcgtcgaatacctcaaccattcctatcgaccaactggcgtcctcgctg
aaacgcccggaaaacttctgtggcatgcacttcttcaacccggtgcatcgtatgccgctg
gtcgaaatcgtacgtggtgagaaaacctcagacaaaacaatttcccgcatcgtctcctac
gcgctgaccatggggaaaacgccggtcgtcgtcaatgactgcccgggcttcttcgttaac
cgcgtactgttcccgtatttctccggtttcagcctgttactgcgtgacggtgccgatttc
cgccagatagacaaagtgatggaaaaacagttcggctggccgatgggcccggcgtatctg
ctggatgtggtcggtatcgacaccgcgcatcacgcacaagcggtgatggccgccggtttc
ccggaccgtatggcgcgggattaccgtgacgccgttgacgtgctgtttgataaccgtcgt
ttcggtcagaagaatcagctcggtttctaccgttacagtgaagacagcaaaggcaagcca
cgcaaggaaatcgacgaacaggcgatcagcctgctgtccgataacctgaaaccggcacat
gcagatttctcaccgcaggacatcatcgcccgcatgatgatcccgatgattaacgaagtg
ctgcgctgttttgaggaaggcatcattgccagtccggcggaagccgacatggcgctggtg
tacggcatcggtttccctccgttccacggcggcccgttccgttatctcgataccctcggc
accgccgaatatctgaaaatgaccgaacagtacgcccatctggggccgatgtatcaggca
ccggcagggttacgcgccaaagcgcaaaccaatgaaagttactatccggttgcggctggg
ctggaaaacctcagcaccggtaatcaggcataa

DBGET integrated database retrieval system