KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4268Help
Entry
Rahaq2_4268       CDS       T01770                                 

Definition
(GenBank) fatty oxidation complex, beta subunit FadA
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00071  Fatty acid degradation
raq00280  Valine, leucine and isoleucine degradation
raq00281  Geraniol degradation
raq00362  Benzoate degradation
raq00592  alpha-Linolenic acid metabolism
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01120  Microbial metabolism in diverse environments
raq01130  Biosynthesis of antibiotics
raq01212  Fatty acid metabolism
Module
raq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rahaq2_4268
   00592 alpha-Linolenic acid metabolism
    Rahaq2_4268
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rahaq2_4268
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Rahaq2_4268
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rahaq2_4268
   00642 Ethylbenzene degradation
    Rahaq2_4268
Enzymes [BR:raq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Rahaq2_4268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEX54021
UniProt: H2IVW6
Position
4542803..4543966
Genome map
AA seq 387 aa AA seqDB search
MENVVIVDAVRTPMGRSKGGAFRHVRAEDLSAHLMRAVLARNPALNAKDIDDIYWGCVQQ
TLEQGFNIARNAALLAEIPHSVPATTVNRLCGSSMQALHDAARAIMVGDAQVSLIGGVEH
MGHVPMNHGVDFHPGLSKTVAKAAGMMGLTAEMLAKMHQISREMQDEFAARSHQRAHAAT
VAGHFANEIVATEGHNADGVLIRYDFDEVIRPETTVATLAALRPAFDPVNGTVTAGTSSA
LSDGASAMLLMSESHAKSLGLKARARIRAMAVVGCDPSIMGYGPVPATRLALKRAGLNVQ
DIGLFELNEAFAAQALPCVKDLGLLETMEERVNLNGGAIALGHPLGCSGSRISTTLLNLM
ERRDVQFGVATMCIGLGQGIATVFERV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgtagtcattgttgacgcagtccgtacgccgatgggccgttcgaaaggcggt
gcattccgccacgtcagggctgaagatctctccgcacatctgatgcgcgccgtgctggcc
cgcaacccggcgctcaatgccaaagatattgatgacatttactggggctgcgtccagcag
acgctggaacaaggcttcaatattgcccgcaatgcggcgctgctggcagaaattccgcac
agcgtaccggcgactacggtcaaccgcctgtgcggttcttccatgcaggcactgcacgac
gcggcgcgcgctattatggttggcgacgcacaggtcagcctgatcggcggcgtggaacat
atgggtcacgtgccgatgaatcacggcgtggatttccatccgggcctgagcaaaactgtc
gcgaaagcggcgggaatgatgggacttacggcggaaatgctggcgaaaatgcaccagatc
agccgtgaaatgcaggatgaatttgccgcacgctcacatcagcgcgcccatgcagccacc
gtggccgggcattttgccaatgaaatcgtggcgaccgaaggtcataacgccgacggcgtt
ctgatccgttatgatttcgacgaagtgatccgtccggaaacgaccgtcgccacactggca
gctttacggccagcgttcgacccggtaaacggtaccgtcacggcgggcacttcctctgcc
ctctccgacggcgcatcagcaatgttgctgatgagtgaatctcatgcgaaatctttaggt
ctgaaagcccgcgcccgtatccgtgcgatggcggtcgttggctgcgacccgtcaattatg
ggttacggcccggtgccggcaacacgtctggcgctgaagcgcgccggactgaacgtacag
gacatcggtttgttcgagctgaacgaagctttcgccgcccaggcgttgccgtgtgtaaaa
gatttgggactgctggaaaccatggaagaacgcgtcaatctgaacggcggcgccattgcg
ctcggtcatccgctcggctgctccggctcgcgtatttccaccaccctgctgaatctgatg
gaacgccgcgacgtacagtttggcgtggcaaccatgtgtatcggtttgggccagggcatc
gcgaccgttttcgaacgcgtctga

DBGET integrated database retrieval system