KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4270Help
Entry
Rahaq2_4270       CDS       T01770                                 

Definition
(GenBank) UbiD family decarboxylase
  KO
K03182  4-hydroxy-3-polyprenylbenzoate decarboxylase [EC:4.1.1.98]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00130  Ubiquinone and other terpenoid-quinone biosynthesis
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
Module
raq_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Rahaq2_4270
Enzymes [BR:raq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.98  4-hydroxy-3-polyprenylbenzoate decarboxylase
     Rahaq2_4270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiD
Motif
Other DBs
NCBI-ProteinID: AEX54023
UniProt: H2IVW8
Position
complement(4544834..4546324)
Genome map
AA seq 496 aa AA seqDB search
MKYRDLRDFLSLLEKRGQLKRISQSVDPYLEMTEIADRTLRAGGPALLFENPKGYDMPVL
CNLFGTPQRVAMGMGKEDVSALREVGELLAFLKEPEPPRGFRDLYDKAPMFKQVLNMPTK
VLHSAPCQQQIWEGDAVDITKIPVMQCWPEDAAPLITWGLTVTRGPNKSRQNLGIYRQQV
LGKNKVIMRWLSHRGGALDFQEWCQQNPGQRFPVSVALGADPATILGAVTPVPDTLSEYA
FAGLLRGNKTEVVKCISNDLEVPASAEIVLEGYIEPGEMAPEGPYGDHTGYYNEVDSFPV
FTITHMTQRKDAIYHSTYTGRPPDEPAVLGVALNEVFVPILKKQFPEIVDFYLPPEGCSY
RLAVVTMKKQYAGHAKRVMMGVWSFLRQFMYTKFVIVCDDDVNARDWNDVIWAITTRMDP
ARDTVLVENTPIDYLDFASPVSGLGSKMGMDATNKWPGETQREWGRPIVKDPEVTARIDA
IWDELAILNDKDDVKK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccgtgatttacgtgacttcctctcgttactcgaaaagagaggccaactgaaa
cgcattagccagtcagttgacccttatctggaaatgaccgaaattgccgatcgtaccctg
cgtgcagggggtccggcgcttttgttcgaaaatccaaaaggctacgacatgccggtcctg
tgcaatttattcggtacacctcaacgtgtggcgatgggcatgggcaaagaagatgtcagt
gcgttgcgggaagtgggtgaattactggcgtttttgaaagagcccgagccgccgcgcgga
tttcgtgatttatacgacaaagcgccgatgtttaaacaggtgctgaacatgccaaccaag
gtgctgcattccgcaccttgtcagcagcagatttgggaaggcgatgcggtcgatatcacc
aaaattccggtgatgcagtgctggccggaagatgccgcgccgcttatcacctggggcctg
actgttacccgtggcccgaacaagtcgcgtcagaatctgggtatttatcgccagcaggtg
ttgggtaaaaataaagtgatcatgcgctggttgtcccatcgcggcggcgcgctcgatttc
caggaatggtgccagcagaatccgggccagcgttttccggtttccgtggcgctgggtgcg
gatccggccacgatcctgggtgctgtgacgccggttcccgatacgctttctgaatatgcc
tttgccgggttgttgcgtggcaacaaaacggaagtggtgaaatgtatttccaacgatctg
gaagtaccggccagcgccgaaattgtgctggaagggtatatcgaaccgggtgaaatggca
ccggaaggcccttatggcgaccataccggctactataatgaagtggatagcttcccggtg
ttcaccattacgcacatgacgcagcgtaaagatgccatctatcattcgacctacactggc
cgtccgccggatgaacctgcagtactgggtgtggcgctgaatgaagtgtttgtgccgatt
ctgaaaaaacagttcccggaaattgttgatttctatctgccgcctgagggttgctcctac
cgtctggctgtcgttaccatgaagaagcagtatgctggccatgcgaaacgcgtgatgatg
ggcgtctggtcattcctgcgtcagttcatgtacaccaagtttgtgattgtgtgcgacgat
gacgtcaatgcccgcgactggaacgacgtgatttgggcgatcaccacccggatggatccc
gcgcgggatacggttctggtggagaataccccgattgattatcttgatttcgcctccccg
gtgtcgggcctcggctcaaaaatggggatggatgcgaccaacaaatggccgggtgaaacg
cagcgtgaatggggacgtccgattgtgaaagatccagaagtcaccgcgcgtatcgacgct
atttgggatgaactcgctattcttaatgataaagacgatgtgaaaaaataa

DBGET integrated database retrieval system