KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4273Help
Entry
Rahaq2_4273       CDS       T01770                                 

Definition
(GenBank) Mg-dependent DNase
  KO
K03424  TatD DNase family protein [EC:3.1.21.-]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
Enzymes [BR:raq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     Rahaq2_4273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TatD_DNase Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: AEX54026
UniProt: H2IVX1
Position
complement(4547981..4548772)
Genome map
AA seq 263 aa AA seqDB search
MFEIGINLTSSQFDKDRPQVVERARAAGLSGMLITGTSAQESVEAQKMADEHPDFCWSTA
GVHPHQASAWNTQVEAGIRELAVLPNVVAIGECGLDFNRNFSPADLQEAAFTAQLALAKE
LQLPVFLHCRDAGERFAALLKPWLSGLPGGVVHCFTGTRQELELYLSLGLSIGITGWVCD
ERRGLELREMLPLIPADRLMLETDAPYLLPRDMENKPKNRRNEPAFLPHIVKQAALWRGE
DPQWLADITDDNARKLFALPLRR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaattggtattaatctcaccagcagtcagttcgataaagaccgtccgcaagtg
gtggaaagagccagagctgccggtctgagcggcatgttgatcaccggaacgtcagcgcag
gaaagtgtcgaagcgcagaaaatggcggatgagcatcctgatttttgctggtcgacggcg
ggtgtacatccgcatcaggcaagtgcctggaatacgcaggttgaagccggtatccgcgaa
ctcgcagtattacccaatgttgttgccatcggtgaatgcgggctggattttaatcgtaac
ttttcgccggcagatctccaggaagcggcttttaccgcgcagctggcgctggcgaaagag
ctacagttaccggtatttctgcactgccgcgatgccggtgagcgctttgccgcgttgctg
aaaccgtggctgtccggtttaccgggcggcgtggttcattgtttcaccggcacccgtcag
gagcttgagttgtatttatctcttggactgtcgattggtattaccggttgggtatgcgat
gaacgtcgcgggctggaactgcgtgaaatgctgccactgatcccggcggacaggttgatg
ctggaaaccgatgcgccatatttactgccgcgtgatatggaaaacaaaccgaaaaaccgt
cgcaatgaaccggctttcctgccgcatatcgtgaagcaggcggccctttggcgtggggag
gatcctcagtggctggcggacattaccgatgacaatgcgcgtaaactttttgccctcccg
ttacgcagatga

DBGET integrated database retrieval system