KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4278Help
Entry
Rahaq2_4278       CDS       T01770                                 

Definition
(GenBank) hypothetical protein
  KO
K03690  ubiquinone biosynthesis protein UbiJ
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
KEGG Orthology (KO) [BR:raq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    Rahaq2_4278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SCP2 Alkyl_sulf_C
Motif
Other DBs
NCBI-ProteinID: AEX54031
UniProt: H2IVX6
Position
complement(4552224..4552832)
Genome map
AA seq 202 aa AA seqDB search
MLLTPLLTAAIETPLNYLLFRDRSMKAARTRLAGKVLRVELQELSTPLTFVFSEQKIDVL
GQWDGAADCTVTSKLSVLHKLRDRQQLSPMMRSGELVVDGDIAVVQQFSALLDMAEIEPA
EFLAPYMGDIAAQGLSQAVQGAFSFLQKGLRHQQSYVAQTLTEEWKMAPGPLEVVWFSDE
VSALVRELDALDKRIKKLEDKP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgttgttaacgccgttactgactgccgctatcgagacgccgctaaattacctgcttttc
agagatcgcagcatgaaggcggcgcgcacacgtctggccggtaaagttttgcgtgtcgaa
ttgcaggaactgagtacaccgctgacgtttgtgttcagtgaacagaaaattgatgtgctc
gggcaatgggacggtgcggcagattgcaccgtcacctcgaaactgtcagtgctgcataag
ttacgtgaccgccagcagttgtcgccaatgatgcgcagtggtgagctggtggttgatggc
gatatcgccgtggttcaacagttttctgcattgctggatatggcggaaattgagcctgct
gaatttctggcaccctatatgggtgacattgcggctcagggcctgagtcaggccgtgcag
ggcgctttcagctttctgcaaaaagggctgagacaccagcagagctatgtggcgcaaacg
ctgactgaagaatggaaaatggcacccggtccgctggaagttgtctggtttagtgatgag
gtttccgcactggtgcgcgagctggatgcgctggataaacgtatcaaaaaactggaggat
aaaccgtga

DBGET integrated database retrieval system