KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4279Help
Entry
Rahaq2_4279       CDS       T01770                                 

Definition
(GenBank) ubiquinone/menaquinone biosynthesis methyltransferase
  KO
K03183  demethylmenaquinone methyltransferase / 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase [EC:2.1.1.163 2.1.1.201]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00130  Ubiquinone and other terpenoid-quinone biosynthesis
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
Module
raq_M00116  Menaquinone biosynthesis, chorismate => menaquinone
raq_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Rahaq2_4279
Enzymes [BR:raq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.163  demethylmenaquinone methyltransferase
     Rahaq2_4279
    2.1.1.201  2-methoxy-6-polyprenyl-1,4-benzoquinol methylase
     Rahaq2_4279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ubie_methyltran Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 PCMT MTS UPF0020 Methyltr_RsmB-F MetW GCD14 RrnaAD NNMT_PNMT_TEMT
Motif
Other DBs
NCBI-ProteinID: AEX54032
UniProt: H2IVX7
Position
complement(4552846..4553601)
Genome map
AA seq 251 aa AA seqDB search
MEKQTPETTHFGFRTVAKDEKQEMVAEVFHSVAAKYDLMNDLMSFGIHRIWKRFTIDCSG
VRQGQRVLDLAGGTGDLTAKFSRLVGEKGEVVLADINDSMLKMGREKLRNLGIVGNVSYV
QANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPVLKPLS
KAYDTYSFHILPRIGELVAHDAESYRYLAESIRMHPDQETLKGMMADAGFENVTYHNLTG
GIVALHRGFKF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcagacgccggaaaccacccattttggttttcgtacagtagccaaagatgaa
aaacaggaaatggtggcagaagtcttccattccgttgcggcaaaatatgatttgatgaat
gacctgatgtctttcggtattcatcgcatctggaaacgcttcactattgattgcagcggt
gtccgtcagggacaacgtgtgctggatctggccggtggtacgggcgatctgaccgctaaa
ttctcccgtctggtgggcgagaaaggcgaagtcgttctggcggatatcaatgattccatg
ctgaagatgggccgcgaaaagctgcgcaatcttggcatcgtcggcaacgtcagctacgtt
caggcgaatgccgaagccctgccgttcccggacaactattttgactgtatcaccatctca
ttcggtctgcgtaacgtgactgaaaaagagaaggcgctgcgttccatgttccgcgtactc
aagccgggcggtcgtctgctggtactggaattctccaaaccggtgctgaaaccgctgagc
aaagcctacgacacctattccttccacattttaccgcgtattggtgagctggttgcgcat
gatgctgaaagctaccggtatctggctgaatcaatccgtatgcatccggatcaggaaaca
ctgaaaggaatgatggcggacgcagggtttgaaaatgtgacttatcacaatctgactggc
ggcattgtggcgttacatcggggtttcaaattctga

DBGET integrated database retrieval system