KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4282Help
Entry
Rahaq2_4282       CDS       T01770                                 

Definition
(GenBank) uridine phosphorylase
  KO
K00757  uridine phosphorylase [EC:2.4.2.3]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00240  Pyrimidine metabolism
raq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rahaq2_4282
Enzymes [BR:raq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.3  uridine phosphorylase
     Rahaq2_4282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: AEX54035
UniProt: H2IVY0
Position
complement(4556119..4556883)
Genome map
AA seq 254 aa AA seqDB search
MSQPEVFHLGLAKKDLNGATLAIVPGDPERVEKIAKLMENPVRLASHREFTSWRAELDGK
SVIVCSTGIGGPSTSIAVEELAQLGIRTFLRVGTTGAIQPHINVGDVLVTTAAVRLDGAS
LHFAPMEFPAVADFACTTALVAAAEAVGAATHIGVTASSDTFYPGQERYDTYSGRVVRRF
KESMKEWQEMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKKTESH
AVKIVVEAARRLIA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagcctgaagttttccatcttggcctggccaaaaaagatttgaacggcgcaacg
ctggcgattgtgcccggcgaccctgagcgcgtagaaaaaattgccaaactgatggagaac
ccggtacgtctggcctcccaccgcgaatttacctcatggcgtgctgaacttgacggcaaa
tctgtgattgtttgctcaaccggtattggtggcccttcgacctccattgccgttgaagaa
ctggcgcaactggggatccgcacttttctgcgtgtcggcacaaccggcgcgatccagcca
cacatcaatgtcggtgacgtgctggtgaccaccgccgccgttcgtcttgatggcgcgagc
ctgcactttgcgccgatggaattccctgcagtagccgattttgcctgcaccaccgcgctg
gttgcagcggcagaagccgtgggtgccgcgacgcacattggcgttaccgcctcttctgac
accttctatccgggtcaggaacgttatgacacatactccggccgtgttgtccgtcgcttc
aaagaatcgatgaaagagtggcaggaaatgggcgtcatgaactacgaaatggaatctgcg
actctgctgaccatgtgtgccagccagggcctgcgcgcaggtatggttgccggtgttatc
gtgaaccgcacgcagcaggaaattcctaatgcggaaaccatgaaaaagaccgaaagccat
gcggtgaagattgttgtcgaagcagcaaggcgtttaatcgcataa

DBGET integrated database retrieval system