KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4285Help
Entry
Rahaq2_4285       CDS       T01770                                 

Definition
(GenBank) fructose-6-phosphate aldolase, TalC/MipB family
  KO
K08313  fructose-6-phosphate aldolase 1 [EC:4.1.2.-]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
KEGG Orthology (KO) [BR:raq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rahaq2_4285
Enzymes [BR:raq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.-  
     Rahaq2_4285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA MLTD_N
Motif
Other DBs
NCBI-ProteinID: AEX54038
UniProt: H2IVY3
Position
complement(4560490..4561152)
Genome map
AA seq 220 aa AA seqDB search
MELYLDTADISAVKRLSRILPLQGVTTNPSIVATSHTSLWEVLPALRDALGGEGKLFAQV
LANQTEQMVEEAELLHSRVPGLVVKVPVTAAGLAAIKILRTRKIPTLGTAVYGAGQGLLS
ALAGAEYVAPYVNRVDAQGGDGIAMVTELQQLLSLHAPHAKVLAASFKTSRQVLACLLAG
CQSVTLPVDVAEQFISAPAVQAAVDKFEQDWQGAFGQLSL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaactttatctggatacggctgatatcagtgcagtaaaacgtttatcgcggattttg
ccgttgcagggcgtgaccactaatccgagcattgtcgctacatcgcacacttccctgtgg
gaggtcttgcccgcgcttcgtgatgcattagggggtgaagggaaactgtttgcacaggtg
ctggcgaatcaaactgagcagatggtggaagaagctgaattgctgcattcccgtgtgccg
ggtctggtggtcaaagtgccggtaaccgccgccgggctggcagcgattaagatcctgcgt
acccgtaaaatcccgacgctgggcactgcggtgtatggtgccgggcaggggttgctgtcg
gcgctggctggtgcagaatatgtggcgccttacgtgaaccgggtggatgcccagggcggt
gatggcattgccatggtgacggagttgcagcaattgctgtccctgcatgcgccgcatgcc
aaagtgctggccgccagttttaaaacatcgcgtcaggtgctggcctgtctgctggcaggt
tgccagtcggtcactcttccggttgacgtagcggagcaatttatcagtgcgcccgccgta
caggcggctgtcgataaatttgaacaggactggcagggtgccttcgggcaactgtcactg
taa

DBGET integrated database retrieval system