KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4292Help
Entry
Rahaq2_4292       CDS       T01770                                 

Definition
(GenBank) 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00270  Cysteine and methionine metabolism
raq00450  Selenocompound metabolism
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01230  Biosynthesis of amino acids
Module
raq_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rahaq2_4292
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rahaq2_4292
Enzymes [BR:raq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     Rahaq2_4292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1
Motif
Other DBs
NCBI-ProteinID: AEX54045
UniProt: H2IVZ0
Position
complement(4569196..4571475)
Genome map
AA seq 759 aa AA seqDB search
MTILNHTLGFPRVGLRRELKKAQESYWAGHSTQEELLATGRELRARHWKQQAEAGVDWVP
VGDFAWYDHVLTTSLLLGNVPARHQNADGSVDLDTLFRLGRGRAPTGKPAAAAEMTKWFN
TNYHYMVPEFVKGQKFKLSWTQLLEEVDEALALGHKVKPVLLGPLTYLWLGKVKGEQFDR
LSLLNDILPVYQQLLAELAKRDIQWVQIDEPALVLELPQQWLDAYKPAYTALEQSKTKLL
LTTYFDSVGHNLDTLRQLPVQGLHIDAVAGRDDLQTVINALPKDWLISLGVINGRNVWRA
DLSTWFERLKPLVEGRNVWIGSSCSLLHSPIDLSVESRLDEEVKSWFAFALQKCAELALL
TSALNNPTAQALQKLAEYSAPIRARRESARVNNPAVGKRVAAITAADIERPNVYTERAKA
QRARFNLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDNTRYRTGISEHIKQAIREQERLD
IDVLVHGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVIIGDVSRPQAITVEW
AKYAQSLTEKPVKGMLTGPLTILCWSFPREDVSREIIARQIALALRDEVEDLEKAGIGII
QIDEPALREGLPLRQSEWNAYLRWAVDAFKLNAAVARDDTQIHTHMCYCEFNDIMDSIAA
LDADVITIETSRSDMDLLESFKDFEYPNEIGPGVYDIHSPNVPSVEWIEDLLRKAADRIP
AERLWVNPDCGLKTRGWPETRESLENMVKAAKRLRAEKA
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgacgatactgaatcacactctgggttttccacgcgttggtctgcgtcgtgaacttaaa
aaagcacaagaaagctactgggcagggcactccactcaggaagaactgctggccaccggc
cgcgaactgcgtgcccgtcactggaaacaacaagctgaagccggcgtggattgggtgccg
gtgggtgatttcgcctggtacgatcacgtactgaccaccagcctgctgctgggtaacgta
ccggcacgtcatcagaatgccgacggctctgttgacctcgataccttattccgtcttggc
cgtggccgtgcaccgaccggtaaaccggctgccgcggcggaaatgaccaaatggtttaac
accaactaccactacatggtgccggagttcgtcaaaggtcagaaattcaaactgagctgg
acacagctgctggaagaagtggacgaagcgctggcgctcggtcacaaggtgaaaccggtt
ctgcttggcccgctgacctatctctggctcggtaaagtgaaaggtgaacagtttgaccgt
ctttccctgctcaacgacatcctgcctgtgtatcagcaactgctggctgaactggcaaaa
cgcgacatccaatgggtgcagatcgacgaaccggcactggtgctggaactgccgcagcaa
tggctggatgcgtacaaaccggcttataccgcgctggaacagagcaaaaccaaactgctg
ctgaccacttacttcgacagcgtcgggcataacctcgacacacttcgccagttgccggtt
caggggctgcatattgatgccgtcgccggtcgtgacgatctgcaaaccgtcatcaacgcg
ctgccaaaagactggctgatttctctgggggtgatcaatggccgcaatgtctggcgtgcg
gatctgagcacctggtttgagcgtctgaagccactggttgaaggccgtaatgtctggatc
ggcagctcctgttcactgctgcacagcccgatcgacttaagcgtcgaaagccgtctggat
gaggaagtgaaaagctggttcgccttcgccctgcaaaaatgtgccgagctggcattgctg
acgtctgcgctgaacaatccgactgcacaggcactacagaaactggcggaatacagtgcg
ccaatccgcgcccgccgtgaatctgcccgtgtgaacaatccggcggtcggtaaacgtgtg
gcggcgatcactgccgcagatattgagcgcccgaatgtttacaccgaacgcgccaaagcg
cagcgtgcccgtttcaacctgccggcatggccgacaaccaccatcggctcattcccgcaa
accacggaaatccgcggcctgcgtctggacttcaaacaaggccgtctggataacaccaga
taccgtaccggtatcagtgaacacattaagcaagccatcagagaacaggaacgtctggat
atcgacgtgctggtgcacggtgaagctgaacgtaacgacatggtggaatacttcggcgaa
catctggacggttttgtgtttacgcaaaacggctgggtacaaagctacggttcacgttgc
gtaaaaccgccggtgattatcggcgacgtcagccgtccgcaagccatcaccgtggagtgg
gcgaagtacgcgcagtccctgaccgaaaaaccggtgaaaggcatgctgaccggcccgctt
actattctctgctggtcgttcccgcgtgaagatgtcagccgcgaaatcatcgcccgacaa
atcgcgctggcactgcgtgacgaagtggaagatctggaaaaagccggtatcggtattatc
cagattgacgaaccggcgctgcgggaaggcctgccactgcgccagtcggaatggaatgcc
tacctgcgctgggcggtggatgcgttcaaactgaatgccgcggttgcccgtgacgacacg
caaatccacacccacatgtgttactgcgagttcaacgacatcatggattccattgccgcg
ctggacgcggatgtgatcaccatcgaaacctcacgatccgatatggacttgctggagtcg
tttaaagatttcgaatacccgaacgaaatcgggccgggcgtctatgacattcactcaccg
aatgtacccagcgtggaatggattgaagacctgctgcgtaaagcggcggatcgtattccg
gcagaacgcctgtgggtcaacccggactgcggcctgaaaacccgtggctggccggaaacc
cgtgagtcactggaaaacatggtgaaagccgccaaacgtctgcgtgctgagaaggcctga

DBGET integrated database retrieval system