KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4296Help
Entry
Rahaq2_4296       CDS       T01770                                 

Definition
(GenBank) glycerophosphoryl diester phosphodiesterase
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rahaq2_4296
Enzymes [BR:raq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     Rahaq2_4296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDPD GDPD_2
Motif
Other DBs
NCBI-ProteinID: AEX54049
UniProt: H2IVZ4
Position
complement(4573897..4574637)
Genome map
AA seq 246 aa AA seqDB search
MKAWPYPRIVAHRGGGALAPENTLAAIDTGARYGHTMIEFDAKLAQDGEIFLLHDDTLNR
TSNGWGVAGELPWEKLEKLDAGNWYSAAFKGEKLPLLAQVAERCARHHMMVNIEIKPTTG
TDEKTGTDVALAARELWKDQAVPPLLSSFEFNALVAAKKAAPELPRGLLIDEWHEDWKAL
TDELECVSLHLNHKLLNEERVRAIKDAGLHILVYTVNNPARARELLGWGVDCICTDKIDV
IGPDFV
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctggccatatcctcgcattgtggcacaccgtggcggcggcgcactggcaccg
gaaaatacactggcagccatcgatacgggcgccagatacggtcacaccatgatcgaattt
gacgccaaactggcgcaagacggggaaatcttcctgctacatgacgataccctgaaccgc
accagcaacggctggggcgtggccggtgaattgccgtgggaaaaactcgaaaagctcgat
gccggtaactggtacagcgccgcttttaaaggtgagaaattaccgctgctggcgcaggtg
gccgaacgctgtgcgcgtcatcatatgatggtgaatatcgagatcaaacccaccaccgga
actgatgagaaaaccggcaccgacgtcgcgctggctgcccgtgaattgtggaaagatcag
gccgttccgccgttgctttcttctttcgaattcaatgcgttagttgccgccaaaaaagcc
gcaccggaattgcctcgcggcttactgatcgacgaatggcatgaagactggaaagcactg
accgacgaactggaatgtgtttccctgcacctcaaccataagttattgaacgaagaacgc
gtccgggcgattaaagacgccgggctgcatattctggtgtacacggtgaacaatccggcg
cgcgcgcgtgaattgttgggctggggcgtggactgtatttgtaccgataagattgatgtg
atcgggccggactttgtgtag

DBGET integrated database retrieval system