KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4297Help
Entry
Rahaq2_4297       CDS       T01770                                 

Definition
(GenBank) ATPase component of ABC-type sugar transporter
  KO
K05816  sn-glycerol 3-phosphate transport system ATP-binding protein [EC:3.6.3.20]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq02010  ABC transporters
Module
raq_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:raq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rahaq2_4297
Enzymes [BR:raq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.20  glycerol-3-phosphate-transporting ATPase
     Rahaq2_4297
Transporters [BR:raq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198] [OT]
    Rahaq2_4297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE_2 AAA_21 AAA_16 RsgA_GTPase ATPase_2 SMC_N AAA_22 AAA_33 AAA_29 Mg_chelatase Rad17 AAA_23 AAA AAA_28 NACHT AAA_25 NB-ARC Zeta_toxin AAA_5 AAA_18 RNA_helicase AAA_14
Motif
Other DBs
NCBI-ProteinID: AEX54050
UniProt: H2IVZ5
Position
complement(4574640..4575713)
Genome map
AA seq 357 aa AA seqDB search
MANLKLQAVTKSYDGKNQIIQSIDLDVADGEFIVMVGPSGCGKSTLLRMVAGLERTTSGD
IYINDQRVTELEPKDRGIAMVFQNYALYPHMSVFDNMAYGLKIRGFGKAQILARVEEAAR
ILELGPLLKRKPRELSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQMRLELQQL
HRRLRTTSLYVTHDQVEAMTLAERVIVMNKGIAEQIGTPSEVYRRPASLFVASFIGSPAM
NLLPGQLTTDGTSLVMEDGFELPLPVPRPEWGGRELTVGIRPEHIHLTDDSQKGIPMVLN
TLELLGADNLAHGKLADSGVVVRLSHEVFPTTGSLLRLDFPAKALHFFDTHSGLRME
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatttgaaattacaggcagtgaccaaatcctacgacggcaaaaaccagattatc
caaagcattgatctggacgtcgctgacggcgaattcatcgtgatggtcggcccttccggc
tgtggaaaatccaccctgctgcgcatggtcgccgggctggagcgcaccacctccggtgat
atttatattaacgaccagcgcgtcaccgagctggaaccgaaagatcgcggtatcgcgatg
gtgtttcagaactacgcgctgtacccgcatatgagcgtattcgataacatggcgtatggc
ctgaaaattcgcggcttcggcaaggcgcagatcctcgcccgcgtcgaagaagcggcgcgc
attctcgagctcggcccgctactcaaacgcaaaccgcgtgagctttccggtggccagcgt
cagcgcgtggcgatggggcgcgctatcgtgcgtgaaccggcggtatttctgttcgacgaa
ccgctgtccaatcttgacgccaagctgcgtgtgcagatgcgcctcgaactgcaacagctt
caccgccgtctgcgtaccaccagtttgtacgtcacgcacgatcaggtcgaagccatgacg
ctggcggaacgcgtgatcgtgatgaacaaaggcattgccgaacaaatcggtacgccgtct
gaggtttaccgccgtccggcaagtctgtttgttgccagctttatcggctctccggccatg
aatttattgccgggccagctgaccactgacggtacatcgctggtaatggaagacggattc
gaactgccgttgccggttccacgcccggaatggggaggtcgcgaactgacagtgggcatc
cgtcctgaacatattcatctgactgatgattcgcagaaggggatcccgatggtattgaat
acgctggaactgctgggcgcggataatctggcgcacggcaaactggcggacagcggtgtc
gtggtgcgtttatcccatgaagtattcccgacaaccggttcgctgttgcgcttggatttc
ccggcgaaagcgttacactttttcgatactcacagcggattacggatggaatga

DBGET integrated database retrieval system