KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4298Help
Entry
Rahaq2_4298       CDS       T01770                                 

Definition
(GenBank) ABC-type sugar transport system, permease component
  KO
K05815  sn-glycerol 3-phosphate transport system permease protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq02010  ABC transporters
Module
raq_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:raq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rahaq2_4298
Transporters [BR:raq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198] [OT]
    Rahaq2_4298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEX54051
UniProt: H2IVZ6
Position
complement(4575720..4576565)
Genome map
AA seq 281 aa AA seqDB search
MIENRRGLDIFSHIMLLLGVLVILFPLYVAFVAASLDNKQIFDVPMTLIPGTHLWENIST
IWTQGAGNSSPAFGRMLINSFIMAMVITVGKISVSMLSAYAIVYFRFPLRNLFFWLIFMT
LMLPVEVRIFPTVQVIANLHMLDSYTGLTLPLMASATATFLFRQFFMTLPDELLEAARID
GAGAMRFFWDIVLPLSKTNLAALFVITFIYGWNQYLWPILITSDASMGTAVAGIKSMISS
GDGSTQWNQVMAAMILTLLPPLAVVLLMQRWFVRGLVDSEK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaaaccgcagagggctggatatcttcagccacatcatgctgctgctcggcgtg
ctggtgatcctctttccgttgtacgtcgcgtttgtggcagcctcgctggacaacaaacaa
atttttgacgtgccgatgacgctgatcccgggcacgcatttatgggaaaacatcagcacc
atctggacgcagggcgcaggtaacagcagtccggcattcgggcggatgctgattaatagc
ttcatcatggcgatggtgatcaccgtcggtaagatttcggtatcaatgctgtcggcctac
gccattgtctatttccgtttcccgctgcgtaacctgtttttctggctgatttttatgacg
ctgatgctgccggtggaagtgcgtattttcccgaccgtgcaggtgatcgccaatctgcat
atgctcgacagctacaccggcctgacgctgccgctgatggcgtctgctaccgcgaccttc
ctgttccgtcagttctttatgaccctgcccgatgaattgctggaagcggcgcgtatcgac
ggtgcgggcgcgatgcgcttcttctgggatatcgtgttgccgctgtcaaaaaccaatctt
gccgcgctgttcgtcatcaccttcatctatggctggaaccagtatttgtggccgatcctg
atcaccagcgatgcctcgatgggcacggcggtggcggggattaaaagcatgatttcttcc
ggcgacggctcgacccaatggaatcaggtgatggcggccatgatcctgaccttattgcca
ccgctggcggtggtgctcctgatgcagcgctggtttgtgcgcggcctggtagacagtgag
aagtaa

DBGET integrated database retrieval system