KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4302Help
Entry
Rahaq2_4302       CDS       T01770                                 

Definition
(GenBank) ABC-type branched-chain amino acid transport systems, ATPase component
  KO
K01996  branched-chain amino acid transport system ATP-binding protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq02010  ABC transporters
raq02024  Quorum sensing
Module
raq_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:raq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rahaq2_4302
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rahaq2_4302
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:raq02000]
    Rahaq2_4302
Transporters [BR:raq02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Rahaq2_4302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 BCA_ABC_TP_C RsgA_GTPase AAA_16 AAA_13 SMC_N AAA_23 MMR_HSR1 AAA_15 Cupin_1 AAA_25 AAA_33 SbcCD_C SRP54 NACHT cobW TsaE AAA_28
Motif
Other DBs
NCBI-ProteinID: AEX54055
UniProt: H2IW00
Position
complement(4580438..4581139)
Genome map
AA seq 233 aa AA seqDB search
MLSFNQVSAHYGKIQALHEVSLNINKGEIVTLIGANGAGKTTLLGSLCGEPRATNGSIIF
EGKDITQWQTAKIMRGDIAIVPEGRRVFSRMTVEENLAMGGFFATRDQYQERLERVFTLF
PRLKERRVQRSGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPIIIQQIFDTIQQLR
EEGMTIFLVEQNANQALKLADRGYVLENGHVVLEDTGAALLANEAVRAAYLGA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcatttaatcaggtatccgcccattacggcaaaattcaggcgctgcatgaagtc
agtctgaatattaataaaggggaaatcgtcacgctgatcggcgcgaacggcgcgggtaaa
accacgctgctcggcagtttatgtggcgaaccgcgtgcgacgaacggctccattattttc
gaaggaaaagacatcacgcagtggcagaccgccaaaatcatgcgcggcgacattgcgatt
gtgccggaaggccgccgcgtattttcacgcatgacggtggaagaaaatctggcgatgggc
ggtttttttgccacacgcgatcagtatcaggaacggctggagcgtgtgtttacgctgttc
ccgcgcctgaaagagcgtcgcgtgcagcgttcaggcaccatgtccggcggtgagcaacag
atgctggcgattggccgtgcgctgatgagccagccacgtttgctgctgcttgatgaaccg
tcgctgggtctggcgccgatcatcatccagcagattttcgacaccatccagcaactgcgc
gaagagggcatgaccatcttcctggtcgagcaaaacgccaatcaggcgctgaaactggcc
gatcgcggttacgttctggaaaacggtcacgtggtgctggaagataccggtgcggcattg
ctggcgaacgaagccgtgcgtgcggcctatctcggcgcttaa

DBGET integrated database retrieval system