KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4307Help
Entry
Rahaq2_4307       CDS       T01770                                 

Definition
(GenBank) acetyltransferase, N-acetylglutamate synthase
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3749 Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47
Motif
Other DBs
NCBI-ProteinID: AEX54060
UniProt: H2IWL1
Position
4585877..4586257
Genome map
AA seq 126 aa AA seqDB search
MKLTIKKLTSLSAQDLICLAKIWPEQTESDWQASLQNNRALFAAVFNERILGAVKITLDG
NQGELHDLRVREVTRRRGVGLYLIEDLQAQLPQVKSWTMKADDDAVTAAFMQTCGFTREG
NVWKKS
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaactatcaaaaaactgacgtcactcagcgcgcaggaccttatctgcctggca
aaaatctggccggagcaaactgaaagcgactggcaagccagcctgcaaaacaaccgtgcg
ctgtttgcggcggtgtttaatgaacgtattctgggtgcagtgaaaatcacgctcgacggc
aatcagggtgaactgcatgacctgcgggtgcgggaagtgacccgccgtcgcggagtcgga
ctatatctgatagaagacttgcaggcacaactgccgcaggtgaagagctggacgatgaaa
gcggatgatgacgccgtcaccgcagcatttatgcagacatgcggttttacgcgtgaaggc
aatgtctggaaaaaatcctga

DBGET integrated database retrieval system